Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2740830..2741166 | Replicon | chromosome |
| Accession | NZ_CP124901 | ||
| Organism | Enterococcus faecalis strain EfsC94 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A1J6YG70 |
| Locus tag | QLQ35_RS13360 | Protein ID | WP_002396786.1 |
| Coordinates | 2740830..2740973 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2741117..2741166 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ35_RS13340 (2736987) | 2736987..2737625 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
| QLQ35_RS13345 (2738313) | 2738313..2739929 | + | 1617 | WP_002372620.1 | phosphatase PAP2/LCP family protein | - |
| QLQ35_RS13350 (2740161) | 2740161..2740343 | + | 183 | WP_002424907.1 | type I toxin-antitoxin system toxin PepG1 | - |
| - (2740276) | 2740276..2740460 | - | 185 | NuclAT_7 | - | - |
| - (2740317) | 2740317..2740460 | - | 144 | NuclAT_9 | - | - |
| QLQ35_RS13355 (2740462) | 2740462..2740602 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
| - (2740535) | 2740535..2740736 | - | 202 | NuclAT_6 | - | - |
| QLQ35_RS13360 (2740830) | 2740830..2740973 | + | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
| - (2741117) | 2741117..2741166 | + | 50 | NuclAT_10 | - | Antitoxin |
| - (2740905) | 2740905..2741167 | - | 263 | NuclAT_8 | - | - |
| QLQ35_RS13365 (2741168) | 2741168..2745859 | - | 4692 | WP_104888220.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T281634 WP_002396786.1 NZ_CP124901:2740830-2740973 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT281634 NZ_CP124901:2741117-2741166 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|