Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2560796..2561156 | Replicon | chromosome |
| Accession | NZ_CP124900 | ||
| Organism | Enterococcus faecalis strain EfsC108 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | QLQ58_RS12205 | Protein ID | WP_023894767.1 |
| Coordinates | 2561052..2561156 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2560796..2560864 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ58_RS12190 | 2556343..2557056 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
| QLQ58_RS12195 | 2557318..2560062 | + | 2745 | WP_282897134.1 | glycosyl hydrolase family 65 protein | - |
| QLQ58_RS12200 | 2560077..2560727 | + | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
| - | 2560796..2560864 | + | 69 | - | - | Antitoxin |
| QLQ58_RS12205 | 2561052..2561156 | - | 105 | WP_023894767.1 | putative holin-like toxin | Toxin |
| QLQ58_RS12210 | 2561428..2561571 | - | 144 | WP_282897135.1 | type I toxin-antitoxin system toxin PepG1 | - |
| QLQ58_RS12215 | 2561805..2562776 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| QLQ58_RS12220 | 2562951..2563388 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| QLQ58_RS12225 | 2563521..2564075 | - | 555 | WP_282897136.1 | Maf family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3799.63 Da Isoelectric Point: 10.0079
>T281599 WP_023894767.1 NZ_CP124900:c2561156-2561052 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 105 bp
Antitoxin
Download Length: 69 bp
>AT281599 NZ_CP124900:2560796-2560864 [Enterococcus faecalis]
TGAAAAGAGAGAGATGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATTTTGTT
TGAAAAGAGAGAGATGCGTCAACATACCTCTCTAGTGTAGAGCCGTTTGAGACGGTGACCGATTTTGTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|