Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 318939..319134 | Replicon | chromosome |
Accession | NZ_CP124900 | ||
Organism | Enterococcus faecalis strain EfsC108 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QLQ58_RS01595 | Protein ID | WP_015543884.1 |
Coordinates | 319039..319134 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 318939..319004 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ58_RS01580 | 314566..316314 | + | 1749 | WP_282897203.1 | PTS transporter subunit EIIC | - |
QLQ58_RS01585 | 316305..318338 | + | 2034 | WP_282897204.1 | PRD domain-containing protein | - |
QLQ58_RS01590 | 318349..318783 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 318939..319004 | + | 66 | - | - | Antitoxin |
QLQ58_RS01595 | 319039..319134 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
QLQ58_RS01600 | 319380..321152 | + | 1773 | WP_002387897.1 | PTS mannitol-specific transporter subunit IIBC | - |
QLQ58_RS01605 | 321167..321604 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
QLQ58_RS01610 | 321619..322773 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | flank | IS/Tn | - | - | 322902..323705 | 803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T281592 WP_015543884.1 NZ_CP124900:c319134-319039 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT281592 NZ_CP124900:318939-319004 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|