Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) fst-RNAII/Fst(toxin)
Location 66479..66720 Replicon plasmid p1_EfsC109-2_rep9b
Accession NZ_CP124899
Organism Enterococcus faecalis strain EfsC109-2

Toxin (Protein)


Gene name fst Uniprot ID -
Locus tag QLQ52_RS14455 Protein ID WP_002360667.1
Coordinates 66479..66589 (+) Length 37 a.a.

Antitoxin (RNA)


Gene name RNAII
Locus tag -
Coordinates 66629..66720 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ52_RS14410 (61664) 61664..61870 + 207 Protein_66 transposase -
QLQ52_RS14415 (62400) 62400..63020 + 621 WP_021732893.1 recombinase family protein -
QLQ52_RS14420 (63037) 63037..63324 + 288 WP_010708491.1 hypothetical protein -
QLQ52_RS14425 (63318) 63318..63542 + 225 WP_010708492.1 ultraviolet resistance protein UvrA repressor UvrC -
QLQ52_RS14430 (63603) 63603..63812 + 210 WP_002387638.1 hypothetical protein -
QLQ52_RS14435 (63974) 63974..64126 + 153 WP_225850000.1 DUF6440 family protein -
QLQ52_RS14440 (64553) 64553..65881 + 1329 WP_021732894.1 ultraviolet resistance protein UvrA -
QLQ52_RS14445 (65878) 65878..66228 + 351 WP_002399364.1 hypothetical protein -
QLQ52_RS14450 (66185) 66185..66397 + 213 WP_002360669.1 hypothetical protein -
QLQ52_RS14455 (66479) 66479..66589 + 111 WP_002360667.1 type I toxin-antitoxin system Fst family toxin Toxin
- (66629) 66629..66720 - 92 NuclAT_0 - Antitoxin
- (66629) 66629..66720 - 92 NuclAT_0 - Antitoxin
- (66629) 66629..66720 - 92 NuclAT_0 - Antitoxin
- (66629) 66629..66720 - 92 NuclAT_0 - Antitoxin
QLQ52_RS14460 (66829) 66829..67125 + 297 WP_002360665.1 replication control protein PrgN -
QLQ52_RS14465 (67379) 67379..68161 + 783 WP_002360664.1 ParA family protein -
QLQ52_RS14470 (68154) 68154..68510 + 357 WP_002360663.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - prgB/asc10 1..68769 68769


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin


No domain identified.



Sequences

Toxin        


Download         Length: 37 a.a.        Molecular weight: 4117.92 Da        Isoelectric Point: 4.1672

>T281590 WP_002360667.1 NZ_CP124899:66479-66589 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK

Download         Length: 111 bp

Antitoxin


Download         Length: 92 bp

>AT281590 NZ_CP124899:c66720-66629 [Enterococcus faecalis]
TAAAAATATGTTATACTAAAGGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGA
TTGCTTTTTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References