Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 66479..66693 | Replicon | plasmid p1_EfsC109-2_rep9b |
Accession | NZ_CP124899 | ||
Organism | Enterococcus faecalis strain EfsC109-2 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QLQ52_RS14455 | Protein ID | WP_002360667.1 |
Coordinates | 66479..66589 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 66629..66693 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ52_RS14410 | 61664..61870 | + | 207 | Protein_66 | transposase | - |
QLQ52_RS14415 | 62400..63020 | + | 621 | WP_021732893.1 | recombinase family protein | - |
QLQ52_RS14420 | 63037..63324 | + | 288 | WP_010708491.1 | hypothetical protein | - |
QLQ52_RS14425 | 63318..63542 | + | 225 | WP_010708492.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
QLQ52_RS14430 | 63603..63812 | + | 210 | WP_002387638.1 | hypothetical protein | - |
QLQ52_RS14435 | 63974..64126 | + | 153 | WP_225850000.1 | DUF6440 family protein | - |
QLQ52_RS14440 | 64553..65881 | + | 1329 | WP_021732894.1 | ultraviolet resistance protein UvrA | - |
QLQ52_RS14445 | 65878..66228 | + | 351 | WP_002399364.1 | hypothetical protein | - |
QLQ52_RS14450 | 66185..66397 | + | 213 | WP_002360669.1 | hypothetical protein | - |
QLQ52_RS14455 | 66479..66589 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 66629..66693 | - | 65 | - | - | Antitoxin |
QLQ52_RS14460 | 66829..67125 | + | 297 | WP_002360665.1 | replication control protein PrgN | - |
QLQ52_RS14465 | 67379..68161 | + | 783 | WP_002360664.1 | ParA family protein | - |
QLQ52_RS14470 | 68154..68510 | + | 357 | WP_002360663.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | prgB/asc10 | 1..68769 | 68769 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T281588 WP_002360667.1 NZ_CP124899:66479-66589 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 65 bp
>AT281588 NZ_CP124899:c66693-66629 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|