Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 2765407..2765602 | Replicon | chromosome |
Accession | NZ_CP124898 | ||
Organism | Enterococcus faecalis strain EfsC109-2 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QLQ52_RS13320 | Protein ID | WP_015543884.1 |
Coordinates | 2765407..2765502 (+) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2765537..2765602 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ52_RS13300 | 2760584..2761699 | + | 1116 | WP_002377910.1 | FAD-dependent oxidoreductase | - |
QLQ52_RS13305 | 2761768..2762922 | - | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
QLQ52_RS13310 | 2762937..2763374 | - | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
QLQ52_RS13315 | 2763389..2765161 | - | 1773 | WP_002391520.1 | PTS mannitol-specific transporter subunit IIBC | - |
QLQ52_RS13320 | 2765407..2765502 | + | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 2765537..2765602 | - | 66 | - | - | Antitoxin |
QLQ52_RS13325 | 2765760..2766194 | - | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
QLQ52_RS13330 | 2766205..2768238 | - | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
QLQ52_RS13335 | 2768229..2769971 | - | 1743 | WP_002401739.1 | PTS transporter subunit EIIC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T281587 WP_015543884.1 NZ_CP124898:2765407-2765502 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT281587 NZ_CP124898:c2765602-2765537 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|