Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relE-dinJ/YafQ-DinJ
Location 2673255..2673789 Replicon chromosome
Accession NZ_CP124898
Organism Enterococcus faecalis strain EfsC109-2

Toxin (Protein)


Gene name relE Uniprot ID R3JX52
Locus tag QLQ52_RS12840 Protein ID WP_002360769.1
Coordinates 2673255..2673530 (-) Length 92 a.a.

Antitoxin (Protein)


Gene name dinJ Uniprot ID R3H6P0
Locus tag QLQ52_RS12845 Protein ID WP_002369771.1
Coordinates 2673523..2673789 (-) Length 89 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLQ52_RS12810 (2668427) 2668427..2668612 - 186 WP_002358660.1 hypothetical protein -
QLQ52_RS12815 (2668642) 2668642..2668971 + 330 WP_002358661.1 LPXTG cell wall anchor domain-containing protein -
QLQ52_RS12820 (2669099) 2669099..2670037 + 939 WP_002370935.1 2-dehydropantoate 2-reductase -
QLQ52_RS12825 (2670063) 2670063..2671100 + 1038 WP_002355369.1 PTS sugar transporter subunit IIC -
QLQ52_RS12830 (2671405) 2671405..2672299 - 895 Protein_2515 IS256 family transposase -
QLQ52_RS12835 (2672420) 2672420..2673064 + 645 WP_002377952.1 IS6 family transposase -
QLQ52_RS12840 (2673255) 2673255..2673530 - 276 WP_002360769.1 type II toxin-antitoxin system YafQ family toxin Toxin
QLQ52_RS12845 (2673523) 2673523..2673789 - 267 WP_002369771.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QLQ52_RS12850 (2673900) 2673900..2674484 - 585 WP_002377949.1 thermonuclease family protein -
QLQ52_RS12855 (2674508) 2674508..2674924 - 417 WP_010710134.1 single-stranded DNA-binding protein -
QLQ52_RS12860 (2675000) 2675000..2675248 - 249 WP_002360773.1 DUF3850 domain-containing protein -
QLQ52_RS12865 (2675261) 2675261..2675761 - 501 WP_002360775.1 DnaJ domain-containing protein -
QLQ52_RS12870 (2675794) 2675794..2676060 - 267 WP_002377947.1 hypothetical protein -
QLQ52_RS12875 (2676652) 2676652..2677140 - 489 WP_010710133.1 hypothetical protein -
QLQ52_RS12880 (2677146) 2677146..2677739 - 594 WP_002414802.1 replication-relaxation family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Integrative and Conjugative Element - esp / cylI / cylA / cylB / cylM / cylS / cylL / cylR1 / cylR2 / bsh 2629895..2693398 63503


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, YafQ-like toxin

(3-91)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-86)


Sequences

Toxin        


Download         Length: 92 a.a.        Molecular weight: 10732.58 Da        Isoelectric Point: 9.6918

>T281586 WP_002360769.1 NZ_CP124898:c2673530-2673255 [Enterococcus faecalis]
MLEIFYTNQFKKDFKKAKKQGKNLEKLKEVLVLLQEQQTLPPKYKDHALTGNYIGTRECHIEPDWLLIYKIDGDKLILTL
ARIGSHSELFR

Download         Length: 276 bp

Antitoxin


Download         Length: 89 a.a.        Molecular weight: 9772.09 Da        Isoelectric Point: 4.4791

>AT281586 WP_002369771.1 NZ_CP124898:c2673789-2673523 [Enterococcus faecalis]
VATTKKKPIHVNVDENLKEEAEQLFDDLGLNMTSAITIFLKQSINEQAIPFMINKGNKETLQALKDIKEGNVHGGFSSVE
DLMEDLNA

Download         Length: 267 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0M2AEA7

Antitoxin

Source ID Structure
AlphaFold DB A0A0M2AED7

References