Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
Location | 39615..39829 | Replicon | plasmid p2_EfsC116_rep9a |
Accession | NZ_CP124896 | ||
Organism | Enterococcus faecalis strain EfsC116 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QLQ63_RS15070 | Protein ID | WP_002360667.1 |
Coordinates | 39615..39725 (+) | Length | 37 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 39765..39829 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ63_RS15050 | 37205..37810 | + | 606 | WP_000238804.1 | recombinase family protein | - |
QLQ63_RS15055 | 37857..39017 | + | 1161 | WP_267594822.1 | Y-family DNA polymerase | - |
QLQ63_RS15060 | 39014..39364 | + | 351 | WP_002400993.1 | hypothetical protein | - |
QLQ63_RS15065 | 39321..39533 | + | 213 | WP_002360669.1 | hypothetical protein | - |
QLQ63_RS15070 | 39615..39725 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
- | 39765..39829 | - | 65 | - | - | Antitoxin |
QLQ63_RS15075 | 39965..40255 | + | 291 | WP_049084802.1 | hypothetical protein | - |
QLQ63_RS15080 | 40359..40730 | - | 372 | WP_000049959.1 | replication-associated protein RepC | - |
QLQ63_RS15085 | 40723..41568 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | cylR2 / cylL / cylS / cylM / cylB / cylA / cylI | 1..42039 | 42039 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T281569 WP_002360667.1 NZ_CP124896:39615-39725 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 65 bp
>AT281569 NZ_CP124896:c39829-39765 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|