Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-RNAII/- |
Location | 2727094..2727495 | Replicon | chromosome |
Accession | NZ_CP124894 | ||
Organism | Enterococcus faecalis strain EfsC116 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | S4BYM2 |
Locus tag | QLQ63_RS13370 | Protein ID | WP_002392696.1 |
Coordinates | 2727094..2727237 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 2727350..2727495 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ63_RS13355 (2722340) | 2722340..2723053 | - | 714 | WP_002367455.1 | trehalose operon repressor | - |
QLQ63_RS13360 (2723315) | 2723315..2726059 | + | 2745 | WP_047648974.1 | glycosyl hydrolase family 65 protein | - |
QLQ63_RS13365 (2726074) | 2726074..2726724 | + | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
- (2726779) | 2726779..2726919 | + | 141 | NuclAT_7 | - | - |
- (2726975) | 2726975..2727120 | + | 146 | NuclAT_9 | - | - |
- (2726975) | 2726975..2727161 | + | 187 | NuclAT_6 | - | - |
QLQ63_RS13370 (2727094) | 2727094..2727237 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- (2727350) | 2727350..2727495 | + | 146 | NuclAT_10 | - | Antitoxin |
- (2727338) | 2727338..2727536 | + | 199 | NuclAT_5 | - | - |
QLQ63_RS13375 (2727469) | 2727469..2727612 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | - |
QLQ63_RS13380 (2727844) | 2727844..2728815 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
QLQ63_RS13385 (2728990) | 2728990..2729427 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
QLQ63_RS13390 (2729560) | 2729560..2730114 | - | 555 | WP_002354869.1 | Maf family protein | - |
QLQ63_RS13395 (2730139) | 2730139..2732271 | - | 2133 | WP_002378991.1 | DNA mismatch repair endonuclease MutL | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T281557 WP_002392696.1 NZ_CP124894:c2727237-2727094 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 146 bp
>AT281557 NZ_CP124894:2727350-2727495 [Enterococcus faecalis]
TGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
GTATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAA
TGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
GTATTATTTAAAAATAACCGTACTGGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAAGCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|