Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 317634..317829 | Replicon | chromosome |
| Accession | NZ_CP124894 | ||
| Organism | Enterococcus faecalis strain EfsC116 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | QLQ63_RS01630 | Protein ID | WP_015543884.1 |
| Coordinates | 317734..317829 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 317634..317699 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ63_RS01615 (313260) | 313260..315008 | + | 1749 | WP_002397549.1 | PTS transporter subunit EIIC | - |
| QLQ63_RS01620 (314999) | 314999..317032 | + | 2034 | WP_002397548.1 | BglG family transcription antiterminator | - |
| QLQ63_RS01625 (317043) | 317043..317477 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
| - (317634) | 317634..317699 | + | 66 | NuclAT_13 | - | Antitoxin |
| QLQ63_RS01630 (317734) | 317734..317829 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| QLQ63_RS01635 (318075) | 318075..319847 | + | 1773 | WP_002405272.1 | PTS mannitol-specific transporter subunit IIBC | - |
| QLQ63_RS01640 (319862) | 319862..320299 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| QLQ63_RS01645 (320314) | 320314..321468 | + | 1155 | WP_002386082.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| QLQ63_RS01650 (321537) | 321537..322652 | - | 1116 | WP_002397546.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T281545 WP_015543884.1 NZ_CP124894:c317829-317734 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT281545 NZ_CP124894:317634-317699 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|