Detailed information of TA system TA281528

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): fst-RNAII/Fst(toxin)
• Location: 83772..83986
• Replicon: plasmid p1_EfsC130_rep9a
• Accession: NZ_CP124892
• Organism: Enterococcus faecalis strain EfsC130

Toxin (Protein)

• Gene name: fst
• Uniprot ID: -
• Locus tag: QLQ45_RS13980
• Protein ID: WP_002360667.1
• Coordinates: 83772..83882 (+)
• Length: 37 a.a.

Antitoxin (RNA)

Gene name	RNAII
Locus tag	-
Coordinates	83922..83986 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QLQ45_RS13935	78970..80131	-	1162	Protein_84	IS3 family transposase	-
QLQ45_RS13940	80205..80312	+	108	Protein_85	recombinase family protein	-
QLQ45_RS13945	80302..80616	+	315	WP_002383634.1	hypothetical protein	-
QLQ45_RS13950	80610..80834	+	225	WP_002383635.1	ultraviolet resistance protein UvrA repressor UvrC	-
QLQ45_RS13955	80895..81104	+	210	WP_002382045.1	hypothetical protein	-
QLQ45_RS13960	81116..81418	+	303	WP_002372577.1	DUF6440 family protein	-
QLQ45_RS13965	81846..83174	+	1329	WP_002400994.1	ultraviolet resistance protein UvrA	-
QLQ45_RS13970	83171..83521	+	351	WP_070635582.1	UvaF	-
QLQ45_RS13975	83478..83690	+	213	WP_002360669.1	hypothetical protein	-
QLQ45_RS13980	83772..83882	+	111	WP_002360667.1	type I toxin-antitoxin system Fst family toxin	Toxin
-	83922..83986	-	65	-	-	Antitoxin
QLQ45_RS13985	84122..84412	+	291	WP_001137528.1	hypothetical protein	-
QLQ45_RS13990	84516..84887	-	372	WP_000049959.1	replication-associated protein RepC	-
QLQ45_RS13995	84880..85725	-	846	WP_000239313.1	AAA family ATPase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	-	cylR2 / cylL / cylS / cylM / cylB / cylA / cylI	1..86196	86196
	-	flank	IS/Tn	-	-	78970..79806	836

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Sequences

Toxin

Protein

• Length: 37 a.a.
• Molecular weight: 4117.92 Da
• Isoelectric Point: 4.1672

>T281528 WP_002360667.1 NZ_CP124892:83772-83882 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK

Nucleotide

• Length: 111 bp

Antitoxin

Nucleotide

• Length: 65 bp

>AT281528 NZ_CP124892:c83986-83922 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT

Structures

Antitoxin