Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/Fst(toxin) |
| Location | 83772..83986 | Replicon | plasmid p1_EfsC130_rep9a |
| Accession | NZ_CP124892 | ||
| Organism | Enterococcus faecalis strain EfsC130 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | QLQ45_RS13980 | Protein ID | WP_002360667.1 |
| Coordinates | 83772..83882 (+) | Length | 37 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 83922..83986 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ45_RS13935 | 78970..80131 | - | 1162 | Protein_84 | IS3 family transposase | - |
| QLQ45_RS13940 | 80205..80312 | + | 108 | Protein_85 | recombinase family protein | - |
| QLQ45_RS13945 | 80302..80616 | + | 315 | WP_002383634.1 | hypothetical protein | - |
| QLQ45_RS13950 | 80610..80834 | + | 225 | WP_002383635.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
| QLQ45_RS13955 | 80895..81104 | + | 210 | WP_002382045.1 | hypothetical protein | - |
| QLQ45_RS13960 | 81116..81418 | + | 303 | WP_002372577.1 | DUF6440 family protein | - |
| QLQ45_RS13965 | 81846..83174 | + | 1329 | WP_002400994.1 | ultraviolet resistance protein UvrA | - |
| QLQ45_RS13970 | 83171..83521 | + | 351 | WP_070635582.1 | UvaF | - |
| QLQ45_RS13975 | 83478..83690 | + | 213 | WP_002360669.1 | hypothetical protein | - |
| QLQ45_RS13980 | 83772..83882 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - | 83922..83986 | - | 65 | - | - | Antitoxin |
| QLQ45_RS13985 | 84122..84412 | + | 291 | WP_001137528.1 | hypothetical protein | - |
| QLQ45_RS13990 | 84516..84887 | - | 372 | WP_000049959.1 | replication-associated protein RepC | - |
| QLQ45_RS13995 | 84880..85725 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | cylR2 / cylL / cylS / cylM / cylB / cylA / cylI | 1..86196 | 86196 | |
| - | flank | IS/Tn | - | - | 78970..79806 | 836 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T281528 WP_002360667.1 NZ_CP124892:83772-83882 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 65 bp
>AT281528 NZ_CP124892:c83986-83922 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|