Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2629533..2629931 | Replicon | chromosome |
Accession | NZ_CP124891 | ||
Organism | Enterococcus faecalis strain EfsC130 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | - |
Locus tag | QLQ45_RS12725 | Protein ID | WP_227330998.1 |
Coordinates | 2629533..2629637 (-) | Length | 35 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2629789..2629931 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ45_RS12710 (2624845) | 2624845..2625558 | - | 714 | WP_002354877.1 | trehalose operon repressor | - |
QLQ45_RS12715 (2625819) | 2625819..2628563 | + | 2745 | WP_282874049.1 | glycosyl hydrolase family 65 protein | - |
QLQ45_RS12720 (2628578) | 2628578..2629228 | + | 651 | WP_002383215.1 | beta-phosphoglucomutase | - |
- (2629257) | 2629257..2629371 | + | 115 | NuclAT_10 | - | - |
- (2629413) | 2629413..2629600 | + | 188 | NuclAT_5 | - | - |
QLQ45_RS12725 (2629533) | 2629533..2629637 | - | 105 | WP_227330998.1 | putative holin-like toxin | Toxin |
- (2629789) | 2629789..2629931 | + | 143 | NuclAT_9 | - | Antitoxin |
QLQ45_RS12730 (2630019) | 2630019..2630144 | - | 126 | WP_002383214.1 | hypothetical protein | - |
QLQ45_RS12735 (2630428) | 2630428..2630961 | + | 534 | WP_002416003.1 | CPBP family intramembrane metalloprotease | - |
QLQ45_RS12740 (2631014) | 2631014..2631985 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
QLQ45_RS12745 (2632160) | 2632160..2632597 | - | 438 | WP_010715474.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
QLQ45_RS12750 (2632730) | 2632730..2633284 | - | 555 | WP_002383211.1 | nucleoside triphosphate pyrophosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3827.68 Da Isoelectric Point: 10.0079
>T281525 WP_227330998.1 NZ_CP124891:c2629637-2629533 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIVLIVKLLKNDNKK
MSAYETIQTILGFGMFTIALIVLIVKLLKNDNKK
Download Length: 105 bp
Antitoxin
Download Length: 143 bp
>AT281525 NZ_CP124891:2629789-2629931 [Enterococcus faecalis]
TGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACCGATCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAACA
TGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACCGATCAAAGTTGACGGTTATTTTTTATTGTCATTTTTAACA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|