Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 300345..300539 | Replicon | chromosome |
Accession | NZ_CP124891 | ||
Organism | Enterococcus faecalis strain EfsC130 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QLQ45_RS01530 | Protein ID | WP_015543884.1 |
Coordinates | 300444..300539 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 300345..300409 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ45_RS01515 (295957) | 295957..297705 | + | 1749 | WP_002383675.1 | PTS transporter subunit EIIC | - |
QLQ45_RS01520 (297696) | 297696..299729 | + | 2034 | WP_002383677.1 | BglG family transcription antiterminator | - |
QLQ45_RS01525 (299740) | 299740..300174 | + | 435 | WP_002355276.1 | PTS sugar transporter subunit IIA | - |
- (300345) | 300345..300409 | + | 65 | NuclAT_11 | - | Antitoxin |
QLQ45_RS01530 (300444) | 300444..300539 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
QLQ45_RS01535 (300785) | 300785..302557 | + | 1773 | WP_010715007.1 | PTS mannitol-specific transporter subunit IIBC | - |
QLQ45_RS01540 (302572) | 302572..303009 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
QLQ45_RS01545 (303024) | 303024..304178 | + | 1155 | WP_002383679.1 | mannitol-1-phosphate 5-dehydrogenase | - |
QLQ45_RS01550 (304247) | 304247..305362 | - | 1116 | WP_002383680.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T281518 WP_015543884.1 NZ_CP124891:c300539-300444 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT281518 NZ_CP124891:300345-300409 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|