Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2731543..2731936 | Replicon | chromosome |
| Accession | NZ_CP124890 | ||
| Organism | Enterococcus faecalis strain EfsPF2 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | QLQ38_RS13010 | Protein ID | WP_021164545.1 |
| Coordinates | 2731832..2731936 (+) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2731543..2731697 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ38_RS12990 (2726686) | 2726686..2726901 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
| QLQ38_RS12995 (2727040) | 2727040..2728032 | + | 993 | WP_048949306.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
| QLQ38_RS13000 (2728296) | 2728296..2728934 | - | 639 | WP_002375448.1 | lytic polysaccharide monooxygenase | - |
| QLQ38_RS13005 (2729619) | 2729619..2731235 | + | 1617 | WP_010824297.1 | phosphatase PAP2/LCP family protein | - |
| - (2731308) | 2731308..2731395 | - | 88 | NuclAT_14 | - | - |
| - (2731509) | 2731509..2731685 | - | 177 | NuclAT_10 | - | - |
| - (2731543) | 2731543..2731697 | - | 155 | NuclAT_7 | - | Antitoxin |
| QLQ38_RS13010 (2731832) | 2731832..2731936 | + | 105 | WP_021164545.1 | putative holin-like toxin | Toxin |
| - (2731869) | 2731869..2732124 | - | 256 | NuclAT_3 | - | - |
| QLQ38_RS13015 (2732126) | 2732126..2735884 | - | 3759 | WP_010824298.1 | WxL domain-containing protein | - |
| - (2736235) | 2736235..2736368 | - | 134 | NuclAT_11 | - | - |
| - (2736225) | 2736225..2736382 | - | 158 | NuclAT_5 | - | - |
| QLQ38_RS13020 (2736479) | 2736479..2736622 | + | 144 | WP_002396786.1 | putative holin-like toxin | - |
| - (2736766) | 2736766..2736815 | + | 50 | NuclAT_15 | - | - |
| - (2736554) | 2736554..2736816 | - | 263 | NuclAT_9 | - | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3813.70 Da Isoelectric Point: 10.3686
>T281508 WP_021164545.1 NZ_CP124890:2731832-2731936 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDKKK
Download Length: 105 bp
Antitoxin
Download Length: 155 bp
>AT281508 NZ_CP124890:c2731697-2731543 [Enterococcus faecalis]
TTTTTAGGAAAGTGTGCTATAATAATAATGAAAAGAGAGGTATGCGCCAACATACCTCTCTAGTGTAGAGCGGTTTAAGA
CGGTGACCTTTTGGATTATTTAAAAATAACCGTACTTGGTCAAAGTAGACGGTTATTTTTTCTTGTCTTCTTTAA
TTTTTAGGAAAGTGTGCTATAATAATAATGAAAAGAGAGGTATGCGCCAACATACCTCTCTAGTGTAGAGCGGTTTAAGA
CGGTGACCTTTTGGATTATTTAAAAATAACCGTACTTGGTCAAAGTAGACGGTTATTTTTTCTTGTCTTCTTTAA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|