Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2629547..2629946 | Replicon | chromosome |
| Accession | NZ_CP124890 | ||
| Organism | Enterococcus faecalis strain EfsPF2 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | QLQ38_RS12540 | Protein ID | WP_023894767.1 |
| Coordinates | 2629547..2629651 (-) | Length | 35 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2629803..2629946 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ38_RS12525 (2624843) | 2624843..2627587 | + | 2745 | WP_048949538.1 | glycosyl hydrolase family 65 protein | - |
| QLQ38_RS12530 (2627602) | 2627602..2628252 | + | 651 | WP_002419627.1 | beta-phosphoglucomutase | - |
| - (2628321) | 2628321..2628437 | + | 117 | NuclAT_13 | - | - |
| QLQ38_RS12535 (2628713) | 2628713..2629306 | + | 594 | WP_048949539.1 | PBECR4 domain-containing protein | - |
| - (2629427) | 2629427..2629614 | + | 188 | NuclAT_4 | - | - |
| QLQ38_RS12540 (2629547) | 2629547..2629651 | - | 105 | WP_023894767.1 | putative holin-like toxin | Toxin |
| - (2629803) | 2629803..2629944 | + | 142 | NuclAT_6 | - | - |
| - (2629803) | 2629803..2629946 | + | 144 | NuclAT_12 | - | Antitoxin |
| QLQ38_RS12545 (2630034) | 2630034..2630159 | - | 126 | WP_002383214.1 | hypothetical protein | - |
| QLQ38_RS12550 (2630443) | 2630443..2630976 | + | 534 | WP_002385180.1 | CPBP family intramembrane metalloprotease | - |
| QLQ38_RS12555 (2631030) | 2631030..2632001 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| QLQ38_RS12560 (2632176) | 2632176..2632613 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| QLQ38_RS12565 (2632746) | 2632746..2633300 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 35 a.a. Molecular weight: 3799.63 Da Isoelectric Point: 10.0079
>T281506 WP_023894767.1 NZ_CP124890:c2629651-2629547 [Enterococcus faecalis]
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 105 bp
Antitoxin
Download Length: 144 bp
>AT281506 NZ_CP124890:2629803-2629946 [Enterococcus faecalis]
TGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTTTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAACA
TGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTTTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAACA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|