Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-RNAII/- |
| Location | 305808..306003 | Replicon | chromosome |
| Accession | NZ_CP124890 | ||
| Organism | Enterococcus faecalis strain EfsPF2 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | QLQ38_RS01550 | Protein ID | WP_015543884.1 |
| Coordinates | 305908..306003 (-) | Length | 32 a.a. |
Antitoxin (RNA)
| Gene name | RNAII | ||
| Locus tag | - | ||
| Coordinates | 305808..305873 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ38_RS01535 (301435) | 301435..303183 | + | 1749 | WP_048949362.1 | PTS transporter subunit EIIC | - |
| QLQ38_RS01540 (303174) | 303174..305207 | + | 2034 | WP_048949363.1 | BglG family transcription antiterminator | - |
| QLQ38_RS01545 (305218) | 305218..305652 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
| - (305808) | 305808..305873 | + | 66 | NuclAT_18 | - | Antitoxin |
| QLQ38_RS01550 (305908) | 305908..306003 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| QLQ38_RS01555 (306249) | 306249..308021 | + | 1773 | WP_002387897.1 | PTS mannitol-specific transporter subunit IIBC | - |
| QLQ38_RS01560 (308036) | 308036..308473 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
| QLQ38_RS01565 (308488) | 308488..309642 | + | 1155 | WP_002386082.1 | mannitol-1-phosphate 5-dehydrogenase | - |
| QLQ38_RS01570 (309710) | 309710..310825 | - | 1116 | WP_010824378.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T281499 WP_015543884.1 NZ_CP124890:c306003-305908 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT281499 NZ_CP124890:305808-305873 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|