Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 360215..360678 | Replicon | chromosome |
| Accession | NZ_CP124889 | ||
| Organism | Enterococcus faecalis strain EfsPF5 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | S4BYM2 |
| Locus tag | QLQ34_RS01715 | Protein ID | WP_002392696.1 |
| Coordinates | 360535..360678 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 360215..360359 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ34_RS01690 | 356862..357416 | + | 555 | WP_002354869.1 | Maf family protein | - |
| QLQ34_RS01695 | 357549..357986 | + | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| QLQ34_RS01700 | 358161..359132 | + | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| QLQ34_RS01705 | 359186..359461 | - | 276 | WP_224805966.1 | CPBP family intramembrane metalloprotease | - |
| QLQ34_RS01710 | 360002..360127 | + | 126 | WP_002398921.1 | hypothetical protein | - |
| - | 360215..360359 | - | 145 | - | - | Antitoxin |
| QLQ34_RS01715 | 360535..360678 | + | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| QLQ34_RS01720 | 361048..361698 | - | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
| QLQ34_RS01725 | 361713..364457 | - | 2745 | WP_002398920.1 | glycosyl hydrolase family 65 protein | - |
| QLQ34_RS01730 | 364719..365432 | + | 714 | WP_002381063.1 | trehalose operon repressor | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T281491 WP_002392696.1 NZ_CP124889:360535-360678 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 145 bp
>AT281491 NZ_CP124889:c360359-360215 [Enterococcus faecalis]
TTGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGAT
TTTGTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAACA
TTGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGAT
TTTGTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAACA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|