Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2738629..2738965 | Replicon | chromosome |
Accession | NZ_CP124886 | ||
Organism | Enterococcus faecalis strain EfsPF13 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | E2Z0W4 |
Locus tag | QLQ55_RS13350 | Protein ID | WP_002381035.1 |
Coordinates | 2738629..2738772 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2738916..2738965 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ55_RS13330 | 2734730..2735359 | - | 630 | WP_002354763.1 | lytic polysaccharide monooxygenase | - |
QLQ55_RS13335 | 2736052..2737668 | + | 1617 | WP_002381036.1 | phosphatase PAP2/LCP family protein | - |
QLQ55_RS13340 | 2737998..2738141 | + | 144 | WP_002392818.1 | type I toxin-antitoxin system toxin PepG1 | - |
QLQ55_RS13345 | 2738260..2738400 | + | 141 | WP_073340360.1 | putative holin-like toxin | - |
QLQ55_RS13350 | 2738629..2738772 | + | 144 | WP_002381035.1 | putative holin-like toxin | Toxin |
- | 2738916..2738965 | + | 50 | - | - | Antitoxin |
QLQ55_RS13355 | 2738967..2743658 | - | 4692 | WP_010783624.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5202.20 Da Isoelectric Point: 10.0041
>T281458 WP_002381035.1 NZ_CP124886:2738629-2738772 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKENNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT281458 NZ_CP124886:2738916-2738965 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|