Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2659078..2659541 | Replicon | chromosome |
| Accession | NZ_CP124886 | ||
| Organism | Enterococcus faecalis strain EfsPF13 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | S4BYM2 |
| Locus tag | QLQ55_RS12995 | Protein ID | WP_002392696.1 |
| Coordinates | 2659078..2659221 (-) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2659397..2659541 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ55_RS12980 | 2654469..2657213 | + | 2745 | WP_002406717.1 | glycosyl hydrolase family 65 protein | - |
| QLQ55_RS12980 | 2654469..2657213 | + | 2745 | WP_002406717.1 | glycosyl hydrolase family 65 protein | - |
| QLQ55_RS12985 | 2657228..2657878 | + | 651 | WP_002406718.1 | beta-phosphoglucomutase | - |
| QLQ55_RS12985 | 2657228..2657878 | + | 651 | WP_002406718.1 | beta-phosphoglucomutase | - |
| QLQ55_RS12990 | 2658243..2658761 | + | 519 | WP_002354874.1 | PBECR4 domain-containing protein | - |
| QLQ55_RS12990 | 2658243..2658761 | + | 519 | WP_002354874.1 | PBECR4 domain-containing protein | - |
| QLQ55_RS12995 | 2659078..2659221 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| QLQ55_RS12995 | 2659078..2659221 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| - | 2659397..2659541 | + | 145 | - | - | Antitoxin |
| QLQ55_RS13000 | 2659629..2659754 | - | 126 | WP_002383214.1 | hypothetical protein | - |
| QLQ55_RS13000 | 2659629..2659754 | - | 126 | WP_002383214.1 | hypothetical protein | - |
| QLQ55_RS13005 | 2659959..2660165 | + | 207 | WP_224561207.1 | CPBP family intramembrane metalloprotease | - |
| QLQ55_RS13005 | 2659959..2660165 | + | 207 | WP_224561207.1 | CPBP family intramembrane metalloprotease | - |
| QLQ55_RS13010 | 2660218..2661189 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| QLQ55_RS13010 | 2660218..2661189 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
| QLQ55_RS13015 | 2661364..2661801 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| QLQ55_RS13015 | 2661364..2661801 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
| QLQ55_RS13020 | 2661934..2662488 | - | 555 | WP_002354869.1 | Maf family protein | - |
| QLQ55_RS13020 | 2661934..2662488 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T281445 WP_002392696.1 NZ_CP124886:c2659221-2659078 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 145 bp
>AT281445 NZ_CP124886:2659397-2659541 [Enterococcus faecalis]
TTGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGAT
TTTGTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAACA
TTGTGCTATAATGAAAACGAAAAGAGAGATATGCTTCAACATACCTCTCTGATGCAGAGCCGTTTAAGACGGTGACCGAT
TTTGTTACAAAAAATAACCGTACTCAGTCAAAGTAGACGGTTATTTTTTATTGTCATTTTTAACA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|