Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | fst-ratA/Fst(toxin) |
| Location | 62637..62889 | Replicon | plasmid p1_EfsPF15_rep9a |
| Accession | NZ_CP124885 | ||
| Organism | Enterococcus faecalis strain EfsPF15 | ||
Toxin (Protein)
| Gene name | fst | Uniprot ID | - |
| Locus tag | QLQ47_RS14060 | Protein ID | WP_002360667.1 |
| Coordinates | 62637..62747 (+) | Length | 37 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 62787..62889 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ47_RS14015 (57861) | 57861..58448 | + | 588 | WP_260653954.1 | hypothetical protein | - |
| QLQ47_RS14020 (58556) | 58556..59176 | + | 621 | WP_025187554.1 | recombinase family protein | - |
| QLQ47_RS14025 (59166) | 59166..59480 | + | 315 | WP_010774426.1 | hypothetical protein | - |
| QLQ47_RS14030 (59474) | 59474..59698 | + | 225 | WP_002395938.1 | ultraviolet resistance protein UvrA repressor UvrC | - |
| QLQ47_RS14035 (59759) | 59759..59959 | + | 201 | WP_002390466.1 | hypothetical protein | - |
| QLQ47_RS14040 (59980) | 59980..60282 | + | 303 | WP_002360675.1 | DUF6440 family protein | - |
| QLQ47_RS14045 (60711) | 60711..62039 | + | 1329 | WP_002370254.1 | ultraviolet resistance protein UvrA | - |
| QLQ47_RS14050 (62036) | 62036..62386 | + | 351 | WP_002360672.1 | hypothetical protein | - |
| QLQ47_RS14055 (62343) | 62343..62555 | + | 213 | WP_002360669.1 | hypothetical protein | - |
| QLQ47_RS14060 (62637) | 62637..62747 | + | 111 | WP_002360667.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
| - (62787) | 62787..62889 | - | 103 | NuclAT_0 | - | Antitoxin |
| - (62787) | 62787..62889 | - | 103 | NuclAT_0 | - | Antitoxin |
| - (62787) | 62787..62889 | - | 103 | NuclAT_0 | - | Antitoxin |
| - (62787) | 62787..62889 | - | 103 | NuclAT_0 | - | Antitoxin |
| QLQ47_RS14065 (63086) | 63086..63547 | + | 462 | WP_002365946.1 | hypothetical protein | - |
| QLQ47_RS14070 (63718) | 63718..64008 | + | 291 | WP_002365947.1 | hypothetical protein | - |
| QLQ47_RS14075 (64112) | 64112..64483 | - | 372 | WP_000049959.1 | replication-associated protein RepC | - |
| QLQ47_RS14080 (64476) | 64476..65321 | - | 846 | WP_000239313.1 | AAA family ATPase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | asa1 / cylR2 / cylL / cylS / cylM / cylB / cylA / cylI | 1..65792 | 65792 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 37 a.a. Molecular weight: 4117.92 Da Isoelectric Point: 4.1672
>T281431 WP_002360667.1 NZ_CP124885:62637-62747 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK
Download Length: 111 bp
Antitoxin
Download Length: 103 bp
>AT281431 NZ_CP124885:c62889-62787 [Enterococcus faecalis]
TTGACCCAAAATAAAAATGTGCTATACTAAAAGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTAC
GGCGAATAGGATTGCTTTTTTTT
TTGACCCAAAATAAAAATGTGCTATACTAAAAGTGCGAAACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTAC
GGCGAATAGGATTGCTTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
