Detailed information of TA system TA281429

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): fst-RNAII/Fst(toxin)
• Location: 62637..62851
• Replicon: plasmid p1_EfsPF15_rep9a
• Accession: NZ_CP124885
• Organism: Enterococcus faecalis strain EfsPF15

Toxin (Protein)

• Gene name: fst
• Uniprot ID: -
• Locus tag: QLQ47_RS14060
• Protein ID: WP_002360667.1
• Coordinates: 62637..62747 (+)
• Length: 37 a.a.

Antitoxin (RNA)

Gene name	RNAII
Locus tag	-
Coordinates	62787..62851 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QLQ47_RS14015	57861..58448	+	588	WP_260653954.1	hypothetical protein	-
QLQ47_RS14020	58556..59176	+	621	WP_025187554.1	recombinase family protein	-
QLQ47_RS14025	59166..59480	+	315	WP_010774426.1	hypothetical protein	-
QLQ47_RS14030	59474..59698	+	225	WP_002395938.1	ultraviolet resistance protein UvrA repressor UvrC	-
QLQ47_RS14035	59759..59959	+	201	WP_002390466.1	hypothetical protein	-
QLQ47_RS14040	59980..60282	+	303	WP_002360675.1	DUF6440 family protein	-
QLQ47_RS14045	60711..62039	+	1329	WP_002370254.1	ultraviolet resistance protein UvrA	-
QLQ47_RS14050	62036..62386	+	351	WP_002360672.1	hypothetical protein	-
QLQ47_RS14055	62343..62555	+	213	WP_002360669.1	hypothetical protein	-
QLQ47_RS14060	62637..62747	+	111	WP_002360667.1	type I toxin-antitoxin system Fst family toxin	Toxin
-	62787..62851	-	65	-	-	Antitoxin
-	62787..62889	-	103	NuclAT_0	-	-
-	62787..62889	-	103	NuclAT_0	-	-
-	62787..62889	-	103	NuclAT_0	-	-
-	62787..62889	-	103	NuclAT_0	-	-
QLQ47_RS14065	63086..63547	+	462	WP_002365946.1	hypothetical protein	-
QLQ47_RS14070	63718..64008	+	291	WP_002365947.1	hypothetical protein	-
QLQ47_RS14075	64112..64483	-	372	WP_000049959.1	replication-associated protein RepC	-
QLQ47_RS14080	64476..65321	-	846	WP_000239313.1	AAA family ATPase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Non-Mobilizable plasmid	-	asa1 / cylR2 / cylL / cylS / cylM / cylB / cylA / cylI	1..65792	65792

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

No domain identified.

Sequences

Toxin

Protein

• Length: 37 a.a.
• Molecular weight: 4117.92 Da
• Isoelectric Point: 4.1672

>T281429 WP_002360667.1 NZ_CP124885:62637-62747 [Enterococcus faecalis]
VLFVKDLMSLVIAPIFVGLVLEMISRVLDEEDDNRK

Nucleotide

• Length: 111 bp

Antitoxin

Nucleotide

• Length: 65 bp

>AT281429 NZ_CP124885:c62851-62787 [Enterococcus faecalis]
AACGACATTAAATCGTACAAATAACACAAAAAGCAATCCTACGGCGAATAGGATTGCTTTTTTTT

Structures

Antitoxin