Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2779654..2779990 | Replicon | chromosome |
Accession | NZ_CP124884 | ||
Organism | Enterococcus faecalis strain EfsPF15 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | A0A1J6YG70 |
Locus tag | QLQ47_RS13290 | Protein ID | WP_002396786.1 |
Coordinates | 2779654..2779797 (+) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2779941..2779990 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ47_RS13270 (2774771) | 2774771..2774986 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
QLQ47_RS13275 (2775125) | 2775125..2776117 | + | 993 | WP_023894581.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
QLQ47_RS13280 (2776381) | 2776381..2777019 | - | 639 | WP_002378863.1 | lytic polysaccharide monooxygenase | - |
QLQ47_RS13285 (2777705) | 2777705..2779321 | + | 1617 | WP_047648929.1 | phosphatase PAP2/LCP family protein | - |
QLQ47_RS13290 (2779654) | 2779654..2779797 | + | 144 | WP_002396786.1 | putative holin-like toxin | Toxin |
- (2779941) | 2779941..2779990 | + | 50 | NuclAT_14 | - | Antitoxin |
- (2779729) | 2779729..2779991 | - | 263 | NuclAT_11 | - | - |
QLQ47_RS13295 (2779992) | 2779992..2784683 | - | 4692 | WP_282851328.1 | WxL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5203.19 Da Isoelectric Point: 8.6626
>T281428 WP_002396786.1 NZ_CP124884:2779654-2779797 [Enterococcus faecalis]
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYERRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT281428 NZ_CP124884:2779941-2779990 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|