Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | txpA-ratA/- |
Location | 2700758..2701020 | Replicon | chromosome |
Accession | NZ_CP124884 | ||
Organism | Enterococcus faecalis strain EfsPF15 |
Toxin (Protein)
Gene name | txpA | Uniprot ID | S4BYM2 |
Locus tag | QLQ47_RS12950 | Protein ID | WP_002392696.1 |
Coordinates | 2700877..2701020 (-) | Length | 48 a.a. |
Antitoxin (RNA)
Gene name | ratA | ||
Locus tag | - | ||
Coordinates | 2700758..2700944 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ47_RS12935 (2696123) | 2696123..2696836 | - | 714 | WP_002367455.1 | trehalose operon repressor | - |
QLQ47_RS12940 (2697098) | 2697098..2699842 | + | 2745 | WP_047648974.1 | glycosyl hydrolase family 65 protein | - |
QLQ47_RS12945 (2699857) | 2699857..2700507 | + | 651 | WP_002354875.1 | beta-phosphoglucomutase | - |
- (2700562) | 2700562..2700702 | + | 141 | NuclAT_10 | - | - |
- (2700758) | 2700758..2700903 | + | 146 | NuclAT_12 | - | - |
- (2700758) | 2700758..2700944 | + | 187 | NuclAT_9 | - | Antitoxin |
QLQ47_RS12950 (2700877) | 2700877..2701020 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
- (2701133) | 2701133..2701278 | + | 146 | NuclAT_13 | - | - |
- (2701121) | 2701121..2701319 | + | 199 | NuclAT_8 | - | - |
QLQ47_RS12955 (2701252) | 2701252..2701395 | - | 144 | WP_002392696.1 | type I toxin-antitoxin system toxin PepG1 | - |
QLQ47_RS12960 (2701627) | 2701627..2702598 | - | 972 | WP_002381060.1 | ribose-phosphate diphosphokinase | - |
QLQ47_RS12965 (2702773) | 2702773..2703210 | - | 438 | WP_002354871.1 | peptide-methionine (R)-S-oxide reductase MsrB | - |
QLQ47_RS12970 (2703343) | 2703343..2703897 | - | 555 | WP_002354869.1 | Maf family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5297.43 Da Isoelectric Point: 10.6867
>T281419 WP_002392696.1 NZ_CP124884:c2701020-2700877 [Enterococcus faecalis]
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
MSVLPKFTERRGLLSAYETIQTILGFGMFTIALIALIVKLLKNDNKK
Download Length: 144 bp
Antitoxin
Download Length: 187 bp
>AT281419 NZ_CP124884:2700758-2700944 [Enterococcus faecalis]
TGTGCTATAATGAAAACGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAAGCAATTTCACAATCAGCG
CAATCAAAGCAATGGTAAACATACCAA
TGTGCTATAATGAAAACGAAAAGAGAGATATGCGTCAACATACCTCTCTGATGTAGAGCCGTTTAAGACGGTGACCGATT
TTGTTACAAAAAATAACCGTACTCGATCAAAGTAAACGGTTATTTTTTATTGTCATTTTTAAGCAATTTCACAATCAGCG
CAATCAAAGCAATGGTAAACATACCAA
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|