Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 317643..317838 | Replicon | chromosome |
Accession | NZ_CP124884 | ||
Organism | Enterococcus faecalis strain EfsPF15 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QLQ47_RS01620 | Protein ID | WP_015543884.1 |
Coordinates | 317743..317838 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 317643..317708 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ47_RS01605 (313269) | 313269..315017 | + | 1749 | WP_002397549.1 | PTS transporter subunit EIIC | - |
QLQ47_RS01610 (315008) | 315008..317041 | + | 2034 | WP_002397548.1 | BglG family transcription antiterminator | - |
QLQ47_RS01615 (317052) | 317052..317486 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- (317643) | 317643..317708 | + | 66 | NuclAT_15 | - | Antitoxin |
QLQ47_RS01620 (317743) | 317743..317838 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
QLQ47_RS01625 (318084) | 318084..319856 | + | 1773 | WP_002405272.1 | PTS mannitol-specific transporter subunit IIBC | - |
QLQ47_RS01630 (319871) | 319871..320308 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
QLQ47_RS01635 (320323) | 320323..321477 | + | 1155 | WP_002386082.1 | mannitol-1-phosphate 5-dehydrogenase | - |
QLQ47_RS01640 (321546) | 321546..322661 | - | 1116 | WP_002397546.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T281406 WP_015543884.1 NZ_CP124884:c317838-317743 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 66 bp
>AT281406 NZ_CP124884:317643-317708 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATCAGTAGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|