Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-ratA/- |
| Location | 2842130..2842466 | Replicon | chromosome |
| Accession | NZ_CP124882 | ||
| Organism | Enterococcus faecalis strain EfsPF20 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | A0A125WAU0 |
| Locus tag | QLQ60_RS13810 | Protein ID | WP_002391551.1 |
| Coordinates | 2842130..2842273 (+) | Length | 48 a.a. |
Antitoxin (RNA)
| Gene name | ratA | ||
| Locus tag | - | ||
| Coordinates | 2842417..2842466 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLQ60_RS13795 | 2837846..2838478 | - | 633 | WP_002358972.1 | RloB family protein | - |
| QLQ60_RS13800 | 2838487..2839782 | - | 1296 | WP_002371641.1 | ATP-binding protein | - |
| QLQ60_RS13805 | 2840244..2841860 | + | 1617 | WP_002365430.1 | phosphatase PAP2/LCP family protein | - |
| QLQ60_RS13810 | 2842130..2842273 | + | 144 | WP_002391551.1 | putative holin-like toxin | Toxin |
| - | 2842417..2842466 | + | 50 | - | - | Antitoxin |
| QLQ60_RS13815 | 2842468..2847159 | - | 4692 | WP_002399468.1 | WxL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 48 a.a. Molecular weight: 5175.17 Da Isoelectric Point: 8.6389
>T281400 WP_002391551.1 NZ_CP124882:2842130-2842273 [Enterococcus faecalis]
MNVSTKIYEKRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
MNVSTKIYEKRGLLSIAEALALMISFGSFIATLIFGILEAVKEDNKK
Download Length: 144 bp
Antitoxin
Download Length: 50 bp
>AT281400 NZ_CP124882:2842417-2842466 [Enterococcus faecalis]
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
AATAAAAATGCCCGAGCCTTAGAAAAATAAGAGGCTCGGGCATTTTTATT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|