Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | fst-RNAII/- |
Location | 319717..319911 | Replicon | chromosome |
Accession | NZ_CP124882 | ||
Organism | Enterococcus faecalis strain EfsPF20 |
Toxin (Protein)
Gene name | fst | Uniprot ID | - |
Locus tag | QLQ60_RS01625 | Protein ID | WP_015543884.1 |
Coordinates | 319816..319911 (-) | Length | 32 a.a. |
Antitoxin (RNA)
Gene name | RNAII | ||
Locus tag | - | ||
Coordinates | 319717..319781 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLQ60_RS01610 | 315335..317077 | + | 1743 | WP_002391519.1 | PTS transporter subunit EIIC | - |
QLQ60_RS01615 | 317068..319101 | + | 2034 | WP_002355275.1 | BglG family transcription antiterminator | - |
QLQ60_RS01620 | 319112..319546 | + | 435 | WP_002358391.1 | PTS sugar transporter subunit IIA | - |
- | 319717..319781 | + | 65 | - | - | Antitoxin |
QLQ60_RS01625 | 319816..319911 | - | 96 | WP_015543884.1 | type I toxin-antitoxin system Fst family toxin | Toxin |
QLQ60_RS01630 | 320157..321929 | + | 1773 | WP_002391520.1 | PTS mannitol-specific transporter subunit IIBC | - |
QLQ60_RS01635 | 321944..322381 | + | 438 | WP_002355279.1 | PTS sugar transporter subunit IIA | - |
QLQ60_RS01640 | 322396..323550 | + | 1155 | WP_002355280.1 | mannitol-1-phosphate 5-dehydrogenase | - |
QLQ60_RS01645 | 323619..324734 | - | 1116 | WP_002364956.1 | FAD-dependent oxidoreductase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 32 a.a. Molecular weight: 3659.47 Da Isoelectric Point: 4.6275
>T281384 WP_015543884.1 NZ_CP124882:c319911-319816 [Enterococcus faecalis]
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
MYEIVTKILVPIFVGIVLKLVTIWLEKQNEE
Download Length: 96 bp
Antitoxin
Download Length: 65 bp
>AT281384 NZ_CP124882:319717-319781 [Enterococcus faecalis]
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
CTTGTGACAAAGTCGTGCATGGATGCACTAAAAAGACACCCTATTGTGGTAGGGTGTCTTTTTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|