Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 324274..324860 Replicon chromosome
Accession NZ_CP124873
Organism Klebsiella pneumoniae strain K82

Toxin (Protein)


Gene name doc Uniprot ID W8VD46
Locus tag QKW38_RS01505 Protein ID WP_002920800.1
Coordinates 324492..324860 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag QKW38_RS01500 Protein ID WP_004174006.1
Coordinates 324274..324495 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QKW38_RS01480 (320431) 320431..321357 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QKW38_RS01485 (321354) 321354..322631 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
QKW38_RS01490 (322628) 322628..323395 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QKW38_RS01495 (323397) 323397..324110 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QKW38_RS01500 (324274) 324274..324495 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QKW38_RS01505 (324492) 324492..324860 + 369 WP_002920800.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QKW38_RS01510 (325133) 325133..326449 + 1317 WP_002920796.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QKW38_RS01515 (326556) 326556..327443 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QKW38_RS01520 (327440) 327440..328285 + 846 WP_004145129.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QKW38_RS01525 (328287) 328287..329357 + 1071 WP_002920787.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 321354..330094 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.92 Da        Isoelectric Point: 8.6410

>T281369 WP_002920800.1 NZ_CP124873:324492-324860 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT281369 WP_004174006.1 NZ_CP124873:324274-324495 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GUD1

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References