Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 39855..40119 Replicon plasmid pM7b
Accession NZ_CP124868
Organism Klebsiella quasipneumoniae strain M7

Toxin (Protein)


Gene name pndA Uniprot ID U9Z417
Locus tag QJS48_RS25820 Protein ID WP_001387489.1
Coordinates 39967..40119 (+) Length 51 a.a.

Antitoxin (RNA)


Gene name pndB
Locus tag -
Coordinates 39855..39915 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QJS48_RS25805 (35957) 35957..37027 - 1071 WP_012783932.1 IncI1-type conjugal transfer protein TrbB -
QJS48_RS25810 (37046) 37046..38254 - 1209 WP_001703845.1 IncI1-type conjugal transfer protein TrbA -
- (38434) 38434..38491 - 58 NuclAT_1 - -
- (38434) 38434..38491 - 58 NuclAT_1 - -
- (38434) 38434..38491 - 58 NuclAT_1 - -
- (38434) 38434..38491 - 58 NuclAT_1 - -
QJS48_RS25815 (38561) 38561..39340 - 780 WP_275450201.1 protein FinQ -
- (39855) 39855..39915 - 61 NuclAT_0 - Antitoxin
- (39855) 39855..39915 - 61 NuclAT_0 - Antitoxin
- (39855) 39855..39915 - 61 NuclAT_0 - Antitoxin
- (39855) 39855..39915 - 61 NuclAT_0 - Antitoxin
QJS48_RS25820 (39967) 39967..40119 + 153 WP_001387489.1 Hok/Gef family protein Toxin
QJS48_RS25825 (40191) 40191..40442 - 252 WP_001291964.1 hypothetical protein -
QJS48_RS25830 (40943) 40943..41038 + 96 WP_000609148.1 DinQ-like type I toxin DqlB -
QJS48_RS25835 (41103) 41103..41279 - 177 WP_001054900.1 hypothetical protein -
QJS48_RS25840 (41671) 41671..41880 + 210 WP_000062603.1 HEAT repeat domain-containing protein -
QJS48_RS25845 (41952) 41952..42614 - 663 WP_012783935.1 plasmid IncI1-type surface exclusion protein ExcA -
QJS48_RS25850 (42685) 42685..44853 - 2169 WP_015508354.1 DotA/TraY family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaCTX-M-55 - 1..85705 85705


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(7-46)


Sequences

Toxin        


Download         Length: 51 a.a.        Molecular weight: 5761.10 Da        Isoelectric Point: 8.7948

>T281364 WP_001387489.1 NZ_CP124868:39967-40119 [Klebsiella quasipneumoniae]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR

Download         Length: 153 bp

Antitoxin


Download         Length: 61 bp

>AT281364 NZ_CP124868:c39915-39855 [Klebsiella quasipneumoniae]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB U9Z417

Antitoxin

Download structure file

References