Detailed information of TA system TA281343

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 3412..3681
• Replicon: plasmid pK6328_1
• Accession: NZ_CP124838
• Organism: Klebsiella pneumoniae strain KPN6328

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QHR28_RS27030
• Protein ID: WP_001372321.1
• Coordinates: 3556..3681 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	3412..3477 (-)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QHR28_RS27010	1..2024	+	2024	Protein_0	ParB/RepB/Spo0J family partition protein	-
QHR28_RS27015	2093..2527	+	435	WP_000845953.1	conjugation system SOS inhibitor PsiB	-
QHR28_RS27020	2524..3243	+	720	WP_001276217.1	plasmid SOS inhibition protein A	-
-	3255..3479	+	225	NuclAT_0	-	-
-	3255..3479	+	225	NuclAT_0	-	-
-	3255..3479	+	225	NuclAT_0	-	-
-	3255..3479	+	225	NuclAT_0	-	-
-	3412..3477	-	66	-	-	Antitoxin
QHR28_RS27025	3465..3614	+	150	Protein_3	plasmid maintenance protein Mok	-
QHR28_RS27030	3556..3681	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QHR28_RS27035	4000..4296	-	297	Protein_5	hypothetical protein	-
QHR28_RS27040	4596..4892	+	297	WP_001272251.1	hypothetical protein	-
QHR28_RS27045	5003..5824	+	822	WP_001234445.1	DUF932 domain-containing protein	-
QHR28_RS27050	6121..6768	-	648	WP_015059008.1	transglycosylase SLT domain-containing protein	-
QHR28_RS27055	7045..7428	+	384	WP_000124981.1	conjugal transfer relaxosome DNA-binding protein TraM	-
QHR28_RS27060	7619..8305	+	687	WP_015059009.1	PAS domain-containing protein	-
QHR28_RS27065	8399..8626	+	228	WP_001254386.1	conjugal transfer relaxosome protein TraY	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	blaKPC-33 / blaTEM-1B / rmtB	-	1..119030	119030

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T281343 WP_001372321.1 NZ_CP124838:3556-3681 [Klebsiella pneumoniae]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 66 bp

>AT281343 NZ_CP124838:c3477-3412 [Klebsiella pneumoniae]
GTGGACTAGACATAGGGATGCCTCGTGGTGGTTAATGAAAATTAACTTACTACGGGGCTATCTTCT

Structures

Antitoxin