Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 3855708..3856305 | Replicon | chromosome |
Accession | NZ_CP124824 | ||
Organism | Klebsiella pneumoniae strain H53 |
Toxin (Protein)
Gene name | higB | Uniprot ID | R4YIC5 |
Locus tag | QLG18_RS19110 | Protein ID | WP_004142563.1 |
Coordinates | 3855988..3856305 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | R4YH91 |
Locus tag | QLG18_RS19105 | Protein ID | WP_004142561.1 |
Coordinates | 3855708..3855995 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG18_RS19075 (3851788) | 3851788..3852036 | + | 249 | WP_002893037.1 | DUF1158 domain-containing protein | - |
QLG18_RS19080 (3852054) | 3852054..3852395 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
QLG18_RS19085 (3852426) | 3852426..3853541 | - | 1116 | WP_020316605.1 | MBL fold metallo-hydrolase | - |
QLG18_RS19090 (3853721) | 3853721..3854302 | + | 582 | WP_004176968.1 | TetR/AcrR family transcriptional regulator | - |
QLG18_RS19095 (3854302) | 3854302..3854670 | + | 369 | WP_032421096.1 | MmcQ/YjbR family DNA-binding protein | - |
QLG18_RS19100 (3854790) | 3854790..3855443 | + | 654 | WP_004176973.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
QLG18_RS19105 (3855708) | 3855708..3855995 | - | 288 | WP_004142561.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QLG18_RS19110 (3855988) | 3855988..3856305 | - | 318 | WP_004142563.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QLG18_RS19115 (3856490) | 3856490..3857533 | - | 1044 | WP_264864872.1 | DUF2157 domain-containing protein | - |
QLG18_RS19120 (3858200) | 3858200..3859066 | - | 867 | WP_004151823.1 | helix-turn-helix transcriptional regulator | - |
QLG18_RS19125 (3859175) | 3859175..3860602 | + | 1428 | WP_009308097.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T281302 WP_004142563.1 NZ_CP124824:c3856305-3855988 [Klebsiella pneumoniae]
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQLDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M5MXH8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0S3DIQ1 |