Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 733296..734071 | Replicon | chromosome |
Accession | NZ_CP124824 | ||
Organism | Klebsiella pneumoniae strain H53 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | B6ZBI6 |
Locus tag | QLG18_RS03615 | Protein ID | WP_004889762.1 |
Coordinates | 733586..734071 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | W8UEW1 |
Locus tag | QLG18_RS03610 | Protein ID | WP_004150912.1 |
Coordinates | 733296..733589 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG18_RS03590 (728504) | 728504..729106 | - | 603 | WP_004174410.1 | short chain dehydrogenase | - |
QLG18_RS03595 (729204) | 729204..730115 | + | 912 | WP_004181308.1 | LysR family transcriptional regulator | - |
QLG18_RS03600 (730116) | 730116..731264 | - | 1149 | WP_044245511.1 | PLP-dependent aspartate aminotransferase family protein | - |
QLG18_RS03605 (731275) | 731275..732651 | - | 1377 | WP_004217775.1 | cystathionine beta-synthase | - |
QLG18_RS03610 (733296) | 733296..733589 | + | 294 | WP_004150912.1 | DUF1778 domain-containing protein | Antitoxin |
QLG18_RS03615 (733586) | 733586..734071 | + | 486 | WP_004889762.1 | GNAT family N-acetyltransferase | Toxin |
QLG18_RS03620 (734775) | 734775..735368 | + | 594 | WP_004188553.1 | hypothetical protein | - |
QLG18_RS03625 (735465) | 735465..735681 | + | 217 | Protein_712 | transposase | - |
QLG18_RS03635 (736359) | 736359..737072 | - | 714 | WP_002916694.1 | DUF554 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
flank | IS/Tn | - | - | 735465..735617 | 152 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17585.56 Da Isoelectric Point: 8.5144
>T281295 WP_004889762.1 NZ_CP124824:733586-734071 [Klebsiella pneumoniae]
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDSMMLMVTLRDLVN
A
MISAPEPLHAGHILTPFCCGIDSMDHWLKQRAMKNQVTGASRTFVCCDDAKVMAYYSLASSAVTTNTAPGRFRRNMPDPI
PVVVLGRLAVDKSLHGKGVGRALVRDAGLRVIQVAETIGIRGMLVHALSDEARDFYLRVGFEPSPMDSMMLMVTLRDLVN
A
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A447W563 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GVL4 |