Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | phd-doc/Doc-RelB |
| Location | 337167..337753 | Replicon | chromosome |
| Accession | NZ_CP124824 | ||
| Organism | Klebsiella pneumoniae strain H53 | ||
Toxin (Protein)
| Gene name | doc | Uniprot ID | - |
| Locus tag | QLG18_RS01580 | Protein ID | WP_110192263.1 |
| Coordinates | 337385..337753 (+) | Length | 123 a.a. |
Antitoxin (Protein)
| Gene name | phd | Uniprot ID | W9B1V1 |
| Locus tag | QLG18_RS01575 | Protein ID | WP_004174006.1 |
| Coordinates | 337167..337388 (+) | Length | 74 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLG18_RS01555 (333324) | 333324..334250 | + | 927 | WP_002920807.1 | high-affinity branched-chain amino acid ABC transporter permease LivH | - |
| QLG18_RS01560 (334247) | 334247..335524 | + | 1278 | WP_004174005.1 | branched chain amino acid ABC transporter permease LivM | - |
| QLG18_RS01565 (335521) | 335521..336288 | + | 768 | WP_002920803.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG | - |
| QLG18_RS01570 (336290) | 336290..337003 | + | 714 | WP_004145133.1 | high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF | - |
| QLG18_RS01575 (337167) | 337167..337388 | + | 222 | WP_004174006.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QLG18_RS01580 (337385) | 337385..337753 | + | 369 | WP_110192263.1 | type II toxin-antitoxin system death-on-curing family toxin | Toxin |
| QLG18_RS01585 (338026) | 338026..339342 | + | 1317 | WP_004174008.1 | sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB | - |
| QLG18_RS01590 (339449) | 339449..340336 | + | 888 | WP_002920792.1 | sn-glycerol-3-phosphate ABC transporter permease UgpA | - |
| QLG18_RS01595 (340333) | 340333..341178 | + | 846 | WP_004174009.1 | sn-glycerol-3-phosphate ABC transporter permease UgpE | - |
| QLG18_RS01600 (341180) | 341180..342250 | + | 1071 | WP_004150074.1 | sn-glycerol-3-phosphate import ATP-binding protein UgpC | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| inside | Prophage | - | - | 334247..342987 | 8740 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13494.89 Da Isoelectric Point: 9.8274
>T281294 WP_110192263.1 NZ_CP124824:337385-337753 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPGFVGMTVEAAAGQLTLEQIVARLRG
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPGFVGMTVEAAAGQLTLEQIVARLRG
Download Length: 369 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|