281294

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 337167..337753 Replicon chromosome
Accession NZ_CP124824
Organism Klebsiella pneumoniae strain H53

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag QLG18_RS01580 Protein ID WP_110192263.1
Coordinates 337385..337753 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag QLG18_RS01575 Protein ID WP_004174006.1
Coordinates 337167..337388 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QLG18_RS01555 (333324) 333324..334250 + 927 WP_002920807.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
QLG18_RS01560 (334247) 334247..335524 + 1278 WP_004174005.1 branched chain amino acid ABC transporter permease LivM -
QLG18_RS01565 (335521) 335521..336288 + 768 WP_002920803.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
QLG18_RS01570 (336290) 336290..337003 + 714 WP_004145133.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
QLG18_RS01575 (337167) 337167..337388 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QLG18_RS01580 (337385) 337385..337753 + 369 WP_110192263.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QLG18_RS01585 (338026) 338026..339342 + 1317 WP_004174008.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
QLG18_RS01590 (339449) 339449..340336 + 888 WP_002920792.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
QLG18_RS01595 (340333) 340333..341178 + 846 WP_004174009.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
QLG18_RS01600 (341180) 341180..342250 + 1071 WP_004150074.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
inside Prophage - - 334247..342987 8740


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(1-121)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13494.89 Da        Isoelectric Point: 9.8274

>T281294 WP_110192263.1 NZ_CP124824:337385-337753 [Klebsiella pneumoniae]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPGFVGMTVEAAAGQLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT281294 WP_004174006.1 NZ_CP124824:337167-337388 [Klebsiella pneumoniae]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References