Detailed information of TA system TA281289

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 13924..14350
• Replicon: plasmid unnamed1
• Accession: NZ_CP124820
• Organism: Escherichia coli strain C325

Toxin (Protein)

• Gene name: hok
• Uniprot ID: -
• Locus tag: QLG17_RS26470
• Protein ID: WP_001372321.1
• Coordinates: 14225..14350 (+)
• Length: 42 a.a.

Antitoxin (RNA)

Gene name	sok
Locus tag	-
Coordinates	13924..14148 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
QLG17_RS26410 (8991)	8991..9308	+	318	Protein_12	hypothetical protein	-
QLG17_RS26415 (9726)	9726..10151	+	426	WP_025380724.1	antirestriction protein	-
QLG17_RS26420 (10121)	10121..10615	+	495	WP_025380723.1	DUF1380 family protein	-
QLG17_RS26425 (10612)	10612..10803	+	192	WP_001027500.1	hypothetical protein	-
QLG17_RS26430 (11415)	11415..11621	+	207	WP_000547944.1	hypothetical protein	-
QLG17_RS26435 (11647)	11647..12186	+	540	WP_025380722.1	single-stranded DNA-binding protein	-
QLG17_RS26440 (12249)	12249..12482	+	234	WP_000005990.1	DUF905 family protein	-
QLG17_RS26445 (12510)	12510..12707	+	198	Protein_19	hypothetical protein	-
QLG17_RS26450 (12762)	12762..13196	+	435	WP_025380720.1	conjugation system SOS inhibitor PsiB	-
QLG17_RS26455 (13193)	13193..13955	+	763	Protein_21	plasmid SOS inhibition protein A	-
QLG17_RS26460 (13924)	13924..14112	-	189	WP_001299721.1	hypothetical protein	-
- (13924)	13924..14148	+	225	NuclAT_0	-	Antitoxin
- (13924)	13924..14148	+	225	NuclAT_0	-	Antitoxin
- (13924)	13924..14148	+	225	NuclAT_0	-	Antitoxin
- (13924)	13924..14148	+	225	NuclAT_0	-	Antitoxin
QLG17_RS26465 (14134)	14134..14283	+	150	Protein_23	plasmid maintenance protein Mok	-
QLG17_RS26470 (14225)	14225..14350	+	126	WP_001372321.1	type I toxin-antitoxin system Hok family toxin	Toxin
QLG17_RS26475 (14570)	14570..14800	+	231	WP_001426396.1	hypothetical protein	-
QLG17_RS26480 (14798)	14798..14971	-	174	Protein_26	hypothetical protein	-
QLG17_RS26485 (15041)	15041..15247	+	207	WP_000547968.1	hypothetical protein	-
QLG17_RS26490 (15272)	15272..15559	+	288	WP_000107535.1	hypothetical protein	-
QLG17_RS26495 (15677)	15677..16498	+	822	WP_001234426.1	DUF932 domain-containing protein	-
QLG17_RS26500 (16795)	16795..17442	-	648	WP_122994606.1	transglycosylase SLT domain-containing protein	-
QLG17_RS26505 (17719)	17719..17955	+	237	Protein_31	conjugal transfer relaxosome DNA-binding protein TraM	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	hlyC / hlyA / hlyB / hlyD / stcE / exeE / exeG	1..87527	87527

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (2-37)

Sequences

Toxin

Protein

• Length: 42 a.a.
• Molecular weight: 4780.69 Da
• Isoelectric Point: 8.5110

>T281289 WP_001372321.1 NZ_CP124820:14225-14350 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK

Nucleotide

• Length: 126 bp

Antitoxin

Nucleotide

• Length: 225 bp

>AT281289 NZ_CP124820:13924-14148 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT

Structures

Antitoxin