Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 13924..14350 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP124820 | ||
| Organism | Escherichia coli strain C325 | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | - |
| Locus tag | QLG17_RS26470 | Protein ID | WP_001372321.1 |
| Coordinates | 14225..14350 (+) | Length | 42 a.a. |
Antitoxin (RNA)
| Gene name | sok | ||
| Locus tag | - | ||
| Coordinates | 13924..14148 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLG17_RS26410 (8991) | 8991..9308 | + | 318 | Protein_12 | hypothetical protein | - |
| QLG17_RS26415 (9726) | 9726..10151 | + | 426 | WP_025380724.1 | antirestriction protein | - |
| QLG17_RS26420 (10121) | 10121..10615 | + | 495 | WP_025380723.1 | DUF1380 family protein | - |
| QLG17_RS26425 (10612) | 10612..10803 | + | 192 | WP_001027500.1 | hypothetical protein | - |
| QLG17_RS26430 (11415) | 11415..11621 | + | 207 | WP_000547944.1 | hypothetical protein | - |
| QLG17_RS26435 (11647) | 11647..12186 | + | 540 | WP_025380722.1 | single-stranded DNA-binding protein | - |
| QLG17_RS26440 (12249) | 12249..12482 | + | 234 | WP_000005990.1 | DUF905 family protein | - |
| QLG17_RS26445 (12510) | 12510..12707 | + | 198 | Protein_19 | hypothetical protein | - |
| QLG17_RS26450 (12762) | 12762..13196 | + | 435 | WP_025380720.1 | conjugation system SOS inhibitor PsiB | - |
| QLG17_RS26455 (13193) | 13193..13955 | + | 763 | Protein_21 | plasmid SOS inhibition protein A | - |
| QLG17_RS26460 (13924) | 13924..14112 | - | 189 | WP_001299721.1 | hypothetical protein | - |
| - (13924) | 13924..14148 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (13924) | 13924..14148 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (13924) | 13924..14148 | + | 225 | NuclAT_0 | - | Antitoxin |
| - (13924) | 13924..14148 | + | 225 | NuclAT_0 | - | Antitoxin |
| QLG17_RS26465 (14134) | 14134..14283 | + | 150 | Protein_23 | plasmid maintenance protein Mok | - |
| QLG17_RS26470 (14225) | 14225..14350 | + | 126 | WP_001372321.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| QLG17_RS26475 (14570) | 14570..14800 | + | 231 | WP_001426396.1 | hypothetical protein | - |
| QLG17_RS26480 (14798) | 14798..14971 | - | 174 | Protein_26 | hypothetical protein | - |
| QLG17_RS26485 (15041) | 15041..15247 | + | 207 | WP_000547968.1 | hypothetical protein | - |
| QLG17_RS26490 (15272) | 15272..15559 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| QLG17_RS26495 (15677) | 15677..16498 | + | 822 | WP_001234426.1 | DUF932 domain-containing protein | - |
| QLG17_RS26500 (16795) | 16795..17442 | - | 648 | WP_122994606.1 | transglycosylase SLT domain-containing protein | - |
| QLG17_RS26505 (17719) | 17719..17955 | + | 237 | Protein_31 | conjugal transfer relaxosome DNA-binding protein TraM | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | hlyC / hlyA / hlyB / hlyD / stcE / exeE / exeG | 1..87527 | 87527 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 42 a.a. Molecular weight: 4780.69 Da Isoelectric Point: 8.5110
>T281289 WP_001372321.1 NZ_CP124820:14225-14350 [Escherichia coli]
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
VLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 126 bp
Antitoxin
Download Length: 225 bp
>AT281289 NZ_CP124820:13924-14148 [Escherichia coli]
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
TCACACGGATTTCCCGTGAACGGTCTGAATGAGCGGATTATTTTCAGGGAAAGTGAGTGTGGTCAGCGTGCAGGTATATG
GGCTATGATGTGCCCGGCGCTTGAGGCTTTCTGCCTCATGACGTGAAGGTGGTTTGTTGCCGTGTTGTGTGGCAGAAAGA
AGATAGCCCCGTAGTAAGTTAATTTTCATTAACCACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|