Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
| Location | 4618314..4619041 | Replicon | chromosome |
| Accession | NZ_CP124819 | ||
| Organism | Escherichia coli strain C325 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | Q3YYE6 |
| Locus tag | QLG17_RS22950 | Protein ID | WP_000547563.1 |
| Coordinates | 4618314..4618625 (+) | Length | 104 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | - |
| Locus tag | QLG17_RS22955 | Protein ID | WP_000126294.1 |
| Coordinates | 4618622..4619041 (+) | Length | 140 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLG17_RS22920 (4613459) | 4613459..4615168 | + | 1710 | WP_001288147.1 | formate hydrogenlyase subunit HycE | - |
| QLG17_RS22925 (4615178) | 4615178..4615720 | + | 543 | WP_000493785.1 | formate hydrogenlyase subunit HycF | - |
| QLG17_RS22930 (4615720) | 4615720..4616487 | + | 768 | WP_000067400.1 | formate hydrogenlyase subunit HycG | - |
| QLG17_RS22935 (4616484) | 4616484..4616894 | + | 411 | WP_001291921.1 | formate hydrogenlyase assembly protein HycH | - |
| QLG17_RS22940 (4616887) | 4616887..4617354 | + | 468 | WP_000132960.1 | hydrogenase maturation peptidase HycI | - |
| QLG17_RS22945 (4617397) | 4617397..4618152 | + | 756 | WP_001400787.1 | hypothetical protein | - |
| QLG17_RS22950 (4618314) | 4618314..4618625 | + | 312 | WP_000547563.1 | type II toxin-antitoxin system HigB family toxin | Toxin |
| QLG17_RS22955 (4618622) | 4618622..4619041 | + | 420 | WP_000126294.1 | helix-turn-helix domain-containing protein | Antitoxin |
| QLG17_RS22960 (4619155) | 4619155..4620579 | - | 1425 | WP_000110310.1 | 6-phospho-beta-glucosidase AscB | - |
| QLG17_RS22965 (4620588) | 4620588..4622045 | - | 1458 | WP_001107816.1 | PTS cellobiose/arbutin/salicin transporter subunit IIBC | - |
| QLG17_RS22970 (4622306) | 4622306..4623316 | + | 1011 | WP_032161993.1 | DNA-binding transcriptional regulator AscG | - |
| QLG17_RS22975 (4623465) | 4623465..4623992 | + | 528 | WP_001078777.1 | electron transport protein HydN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 12398.11 Da Isoelectric Point: 9.7105
>T281288 WP_000547563.1 NZ_CP124819:4618314-4618625 [Escherichia coli]
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
MHIISKAPFEESARKYPNDALALQALYRVIKETDFSTPEEMRTAFPNLDNFKYRNKWYVLDVGGNNLRVIAYINFVNKRF
FVKHITNHAEYDKLTRYYRENKE
Download Length: 312 bp
Antitoxin
Download Length: 140 a.a. Molecular weight: 15416.42 Da Isoelectric Point: 4.4596
>AT281288 WP_000126294.1 NZ_CP124819:4618622-4619041 [Escherichia coli]
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
MTANAARAVKATRELVNAVPFLGGSDSEDDYREALELVEYLIEEDDTNPLIDFLASRIAEYENNNEKFAEFDKAVAAMPV
GVALLRTLIDQHNLTYADLKNEIGSKSLVSQILSGQRSLTISHIKALSARFGVKPEWFL
Download Length: 420 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|