Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mqsRA (relBE)/MqsR-MqsA |
Location | 4266744..4267437 | Replicon | chromosome |
Accession | NZ_CP124819 | ||
Organism | Escherichia coli strain C325 |
Toxin (Protein)
Gene name | mqsR | Uniprot ID | S1EZG2 |
Locus tag | QLG17_RS21290 | Protein ID | WP_000415584.1 |
Coordinates | 4266744..4267040 (+) | Length | 99 a.a. |
Antitoxin (Protein)
Gene name | mqsA | Uniprot ID | S1EBV2 |
Locus tag | QLG17_RS21295 | Protein ID | WP_000650107.1 |
Coordinates | 4267042..4267437 (+) | Length | 132 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG17_RS21255 (4261793) | 4261793..4262107 | - | 315 | WP_000958598.1 | putative quinol monooxygenase | - |
QLG17_RS21260 (4262138) | 4262138..4262719 | - | 582 | WP_000065430.1 | NADPH:quinone oxidoreductase MdaB | - |
QLG17_RS21265 (4263077) | 4263077..4263373 | + | 297 | WP_000912118.1 | DUF2645 family protein | - |
QLG17_RS21270 (4263455) | 4263455..4264804 | - | 1350 | WP_000673396.1 | quorum sensing histidine kinase QseC | - |
QLG17_RS21275 (4264801) | 4264801..4265460 | - | 660 | WP_001221502.1 | quorum sensing response regulator transcription factor QseB | - |
QLG17_RS21280 (4265612) | 4265612..4266004 | + | 393 | WP_000712658.1 | OB fold stress tolerance protein YgiW | - |
QLG17_RS21285 (4266057) | 4266057..4266539 | + | 483 | WP_000183497.1 | GyrI-like domain-containing protein | - |
QLG17_RS21290 (4266744) | 4266744..4267040 | + | 297 | WP_000415584.1 | type II toxin-antitoxin system toxin MqsR | Toxin |
QLG17_RS21295 (4267042) | 4267042..4267437 | + | 396 | WP_000650107.1 | type II toxin-antitoxin system antitoxin MqsA | Antitoxin |
QLG17_RS21300 (4267570) | 4267570..4269177 | + | 1608 | WP_001400746.1 | ABC transporter substrate-binding protein | - |
QLG17_RS21305 (4269315) | 4269315..4271573 | + | 2259 | WP_052915292.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 99 a.a. Molecular weight: 11231.96 Da Isoelectric Point: 8.9070
>T281285 WP_000415584.1 NZ_CP124819:4266744-4267040 [Escherichia coli]
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
MEKRTPHTRLSQVKKLVNAGQVRTTRSALLNADELGLDFDGMCNVIIGLSESDFYKSMTTYSDHTIWQDVYRPRLVTGQV
YLKITVIHDVLIVSFKEK
Download Length: 297 bp
Antitoxin
Download Length: 132 a.a. Molecular weight: 14703.10 Da Isoelectric Point: 9.2136
>AT281285 WP_000650107.1 NZ_CP124819:4267042-4267437 [Escherichia coli]
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
MKCPVCHQGEMVSGIKDIPYTFRGRKTVLKGIHGLYCVHCEESIMNKEESDAFMAQVKAFRASVNAETVAPEFIVKVRKK
LSLTQKEASEIFGGGVNAFSRYEKGNAQPHPSTIKLLRVLDKHPELLNEIR
Download Length: 396 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|