Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4205692..4206419 | Replicon | chromosome |
Accession | NZ_CP124819 | ||
Organism | Escherichia coli strain C325 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | QLG17_RS21000 | Protein ID | WP_000550189.1 |
Coordinates | 4205692..4206006 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QLG17_RS21005 | Protein ID | WP_052915301.1 |
Coordinates | 4206003..4206419 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG17_RS20980 (4201851) | 4201851..4202837 | - | 987 | WP_024221603.1 | Gfo/Idh/MocA family oxidoreductase | - |
QLG17_RS20985 (4202916) | 4202916..4203606 | - | 691 | Protein_4096 | vancomycin high temperature exclusion protein | - |
QLG17_RS20990 (4203683) | 4203683..4204186 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
QLG17_RS20995 (4204271) | 4204271..4205407 | + | 1137 | WP_025380598.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
QLG17_RS21000 (4205692) | 4205692..4206006 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
QLG17_RS21005 (4206003) | 4206003..4206419 | + | 417 | WP_052915301.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
QLG17_RS21010 (4206464) | 4206464..4208482 | - | 2019 | WP_052915300.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
QLG17_RS21015 (4208786) | 4208786..4210330 | - | 1545 | WP_000258466.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T281284 WP_000550189.1 NZ_CP124819:4205692-4206006 [Escherichia coli]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15025.44 Da Isoelectric Point: 4.4547
>AT281284 WP_052915301.1 NZ_CP124819:4206003-4206419 [Escherichia coli]
MIAITDILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAITDILQAGEKLTAVAPFLAGIQNEEQYTQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|