Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/Tad-HTH_37 |
Location | 4105606..4106203 | Replicon | chromosome |
Accession | NZ_CP124804 | ||
Organism | Klebsiella variicola strain J57 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A0B7GEF2 |
Locus tag | QLG20_RS20130 | Protein ID | WP_012542526.1 |
Coordinates | 4105886..4106203 (-) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QLG20_RS20125 | Protein ID | WP_012542525.1 |
Coordinates | 4105606..4105893 (-) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QLG20_RS20095 (QLG20_20085) | 4101508..4101756 | + | 249 | WP_008805539.1 | DUF1158 domain-containing protein | - |
QLG20_RS20100 (QLG20_20090) | 4101775..4102116 | - | 342 | WP_002893035.1 | RamA family antibiotic efflux transcriptional regulator | - |
QLG20_RS20105 (QLG20_20095) | 4102147..4103262 | - | 1116 | WP_162493283.1 | MBL fold metallo-hydrolase | - |
QLG20_RS20110 (QLG20_20100) | 4103442..4104023 | + | 582 | WP_017899014.1 | TetR/AcrR family transcriptional regulator | - |
QLG20_RS20115 (QLG20_20105) | 4104023..4104391 | + | 369 | WP_008805536.1 | MmcQ/YjbR family DNA-binding protein | - |
QLG20_RS20120 (QLG20_20110) | 4104511..4105164 | + | 654 | WP_012968755.1 | oxygen-insensitive NAD(P)H nitroreductase | - |
QLG20_RS20125 (QLG20_20115) | 4105606..4105893 | - | 288 | WP_012542525.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QLG20_RS20130 (QLG20_20120) | 4105886..4106203 | - | 318 | WP_012542526.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QLG20_RS20135 (QLG20_20125) | 4106388..4107431 | - | 1044 | WP_023297181.1 | hypothetical protein | - |
QLG20_RS20140 (QLG20_20130) | 4107961..4108827 | - | 867 | WP_022065427.1 | helix-turn-helix transcriptional regulator | - |
QLG20_RS20145 (QLG20_20135) | 4108936..4110363 | + | 1428 | WP_124037034.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.39 Da Isoelectric Point: 11.2767
>T281232 WP_012542526.1 NZ_CP124804:c4106203-4105886 [Klebsiella variicola]
MFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
MFRLVVHVDVKKELQALPPIVQAKMIRQIDKLRQNPTALREPDSKPLGQGLFEIRALGSVQGRGIYVFQQGKTLFLLRVF
VKKTQKTPSSEIRLALKRLEEMRNE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|