Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
| Location | 352292..352938 | Replicon | chromosome |
| Accession | NZ_CP124804 | ||
| Organism | Klebsiella variicola strain J57 | ||
Toxin (Protein)
| Gene name | higB | Uniprot ID | - |
| Locus tag | QLG20_RS01610 | Protein ID | WP_124037571.1 |
| Coordinates | 352292..352639 (+) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | higA | Uniprot ID | A0A1F2LZT5 |
| Locus tag | QLG20_RS01615 | Protein ID | WP_008806992.1 |
| Coordinates | 352639..352938 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QLG20_RS01600 (QLG20_01600) | 348179..349612 | + | 1434 | WP_004202133.1 | glycogen synthase GlgA | - |
| QLG20_RS01605 (QLG20_01605) | 349630..352077 | + | 2448 | WP_008806990.1 | glycogen phosphorylase | - |
| QLG20_RS01610 (QLG20_01610) | 352292..352639 | + | 348 | WP_124037571.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QLG20_RS01615 (QLG20_01615) | 352639..352938 | + | 300 | WP_008806992.1 | XRE family transcriptional regulator | Antitoxin |
| QLG20_RS01620 (QLG20_01620) | 353001..354509 | - | 1509 | WP_004202136.1 | glycerol-3-phosphate dehydrogenase | - |
| QLG20_RS01625 (QLG20_01625) | 354714..355043 | + | 330 | WP_004202138.1 | thiosulfate sulfurtransferase GlpE | - |
| QLG20_RS01630 (QLG20_01630) | 355094..355924 | + | 831 | WP_008806994.1 | rhomboid family intramembrane serine protease GlpG | - |
| QLG20_RS01635 (QLG20_01635) | 355974..356732 | + | 759 | WP_008806995.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13522.55 Da Isoelectric Point: 6.2327
>T281222 WP_124037571.1 NZ_CP124804:352292-352639 [Klebsiella variicola]
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKDSTFQNMKELRVQHHGLPMRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDAWFELQSRALKEDMLATMLILSEFGPQLGRPYVDTVKDSTFQNMKELRVQHHGLPMRAFFAFDPLRKAI
VLCAGNKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|