Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 4462971..4463599 | Replicon | chromosome |
Accession | NZ_CP124754 | ||
Organism | Serratia sp. K-E0102 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A221FUH3 |
Locus tag | SSARUM2_RS21155 | Protein ID | WP_033636092.1 |
Coordinates | 4462971..4463261 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | SSARUM2_RS21160 | Protein ID | WP_033636093.1 |
Coordinates | 4463276..4463599 (+) | Length | 108 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SSARUM2_RS21145 (SSARUM2_004229) | 4459386..4461407 | + | 2022 | WP_033654790.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
SSARUM2_RS21150 (SSARUM2_004230) | 4461601..4462740 | - | 1140 | WP_033649017.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
SSARUM2_RS21155 (SSARUM2_004231) | 4462971..4463261 | + | 291 | WP_033636092.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
SSARUM2_RS21160 (SSARUM2_004232) | 4463276..4463599 | + | 324 | WP_033636093.1 | HigA family addiction module antitoxin | Antitoxin |
SSARUM2_RS21165 (SSARUM2_004233) | 4463592..4464104 | + | 513 | WP_060453133.1 | M48 family metallopeptidase | - |
SSARUM2_RS21170 (SSARUM2_004234) | 4464155..4465135 | + | 981 | WP_033636095.1 | Gfo/Idh/MocA family oxidoreductase | - |
SSARUM2_RS21175 (SSARUM2_004235) | 4465137..4465868 | + | 732 | WP_015379152.1 | glutamine amidotransferase | - |
SSARUM2_RS21180 (SSARUM2_004236) | 4466121..4467095 | + | 975 | WP_060453134.1 | TerC family protein | - |
SSARUM2_RS21185 (SSARUM2_004237) | 4467352..4468587 | + | 1236 | WP_033649012.1 | serine/threonine transporter SstT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 11573.23 Da Isoelectric Point: 10.4937
>T281217 WP_033636092.1 NZ_CP124754:4462971-4463261 [Serratia sp. K-E0102]
MIKSFRDRYLEQFYLGGRRSRLIPGALERQLARKLDMLAAAQQERDLHHPTGNYYKRLSGPFQGWSSLRVNMHWRLMFQW
RHDAAEKIYLDPHQDT
MIKSFRDRYLEQFYLGGRRSRLIPGALERQLARKLDMLAAAQQERDLHHPTGNYYKRLSGPFQGWSSLRVNMHWRLMFQW
RHDAAEKIYLDPHQDT
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|