Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3373823..3374483 | Replicon | chromosome |
Accession | NZ_CP124754 | ||
Organism | Serratia sp. K-E0102 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2V4GMA7 |
Locus tag | SSARUM2_RS16200 | Protein ID | WP_033647956.1 |
Coordinates | 3374130..3374483 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A2V4GQ69 |
Locus tag | SSARUM2_RS16195 | Protein ID | WP_033635213.1 |
Coordinates | 3373823..3374125 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SSARUM2_RS16175 (SSARUM2_003235) | 3369453..3370367 | - | 915 | WP_060452541.1 | branched-chain amino acid ABC transporter permease | - |
SSARUM2_RS16180 (SSARUM2_003236) | 3370493..3371611 | - | 1119 | WP_033647954.1 | branched-chain amino acid ABC transporter substrate-binding protein | - |
SSARUM2_RS16190 (SSARUM2_003238) | 3372215..3373423 | - | 1209 | WP_039565158.1 | aldose 1-epimerase family protein | - |
SSARUM2_RS16195 (SSARUM2_003239) | 3373823..3374125 | - | 303 | WP_033635213.1 | XRE family transcriptional regulator | Antitoxin |
SSARUM2_RS16200 (SSARUM2_003240) | 3374130..3374483 | - | 354 | WP_033647956.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
SSARUM2_RS16205 (SSARUM2_003241) | 3374924..3376219 | + | 1296 | WP_048321788.1 | MFS transporter | - |
SSARUM2_RS16210 (SSARUM2_003242) | 3376247..3377053 | + | 807 | WP_048321789.1 | substrate-binding domain-containing protein | - |
SSARUM2_RS16215 (SSARUM2_003243) | 3377028..3377927 | - | 900 | WP_060452540.1 | LysR family transcriptional regulator | - |
SSARUM2_RS16220 (SSARUM2_003244) | 3378020..3378385 | - | 366 | WP_033635218.1 | diacylglycerol kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13460.30 Da Isoelectric Point: 8.9000
>T281213 WP_033647956.1 NZ_CP124754:c3374483-3374130 [Serratia sp. K-E0102]
VWEIKTTDAFDNWFSSLHDADRAGVLAALMILREKGPGLPRPYADTVKGSRYSNMKELRIQSRGEPLRAFFAFDPYRIGI
VLCAGNKAGNEKRFYDRMIQAADREFTNWLNTLNEKE
VWEIKTTDAFDNWFSSLHDADRAGVLAALMILREKGPGLPRPYADTVKGSRYSNMKELRIQSRGEPLRAFFAFDPYRIGI
VLCAGNKAGNEKRFYDRMIQAADREFTNWLNTLNEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2V4GMA7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2V4GQ69 |