Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 4026649..4027301 | Replicon | chromosome |
Accession | NZ_CP124750 | ||
Organism | Serratia sp. K-M0706 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A7D6BTF4 |
Locus tag | SSARUM_RS19100 | Protein ID | WP_033635775.1 |
Coordinates | 4026649..4026993 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A086GAN0 |
Locus tag | SSARUM_RS19105 | Protein ID | WP_004931828.1 |
Coordinates | 4026999..4027301 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SSARUM_RS19090 (SSARUM_003818) | 4022991..4025249 | - | 2259 | WP_048321906.1 | molybdopterin guanine dinucleotide-containing S/N-oxide reductase | - |
SSARUM_RS19095 (SSARUM_003819) | 4025470..4026489 | + | 1020 | WP_033649496.1 | HTH-type transcriptional regulator GalR | - |
SSARUM_RS19100 (SSARUM_003820) | 4026649..4026993 | + | 345 | WP_033635775.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
SSARUM_RS19105 (SSARUM_003821) | 4026999..4027301 | + | 303 | WP_004931828.1 | XRE family transcriptional regulator | Antitoxin |
SSARUM_RS19110 (SSARUM_003822) | 4027329..4028591 | - | 1263 | WP_033649495.1 | diaminopimelate decarboxylase | - |
SSARUM_RS19115 (SSARUM_003823) | 4028725..4029648 | + | 924 | WP_033649494.1 | LysR family transcriptional regulator | - |
SSARUM_RS19120 (SSARUM_003824) | 4029676..4030584 | - | 909 | WP_015378928.1 | LysR family transcriptional regulator | - |
SSARUM_RS19125 (SSARUM_003825) | 4030693..4031577 | + | 885 | WP_033635778.1 | MBL fold metallo-hydrolase | - |
SSARUM_RS19130 (SSARUM_003826) | 4031646..4032293 | + | 648 | WP_033649493.1 | DsbA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13409.48 Da Isoelectric Point: 10.6087
>T281199 WP_033635775.1 NZ_CP124750:4026649-4026993 [Serratia sp. K-M0706]
MWQVVTVERFDDWFLALNNAQQTSILAAIFKLQTFGPQLTRPHADTLYFSDAVRQLKELRVQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
MWQVVTVERFDDWFLALNNAQQTSILAAIFKLQTFGPQLTRPHADTLYFSDAVRQLKELRVQHRGRPFRVFFAFDPQRQA
VLLCGGDKTGDKRFYQRMLPIAAMEFSHYLATRR
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7D6BTF4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A086GAN0 |