Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 3287787..3288447 | Replicon | chromosome |
Accession | NZ_CP124750 | ||
Organism | Serratia sp. K-M0706 |
Toxin (Protein)
Gene name | higB | Uniprot ID | A0A2V4GMA7 |
Locus tag | SSARUM_RS15665 | Protein ID | WP_033647956.1 |
Coordinates | 3288094..3288447 (-) | Length | 118 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | A0A2V4GQ69 |
Locus tag | SSARUM_RS15660 | Protein ID | WP_033635213.1 |
Coordinates | 3287787..3288089 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
SSARUM_RS15640 (SSARUM_003128) | 3283417..3284331 | - | 915 | WP_004928592.1 | branched-chain amino acid ABC transporter permease | - |
SSARUM_RS15645 (SSARUM_003129) | 3284457..3285575 | - | 1119 | WP_033647954.1 | branched-chain amino acid ABC transporter substrate-binding protein | - |
SSARUM_RS15655 (SSARUM_003131) | 3286179..3287387 | - | 1209 | WP_033647955.1 | aldose 1-epimerase family protein | - |
SSARUM_RS15660 (SSARUM_003132) | 3287787..3288089 | - | 303 | WP_033635213.1 | XRE family transcriptional regulator | Antitoxin |
SSARUM_RS15665 (SSARUM_003133) | 3288094..3288447 | - | 354 | WP_033647956.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
SSARUM_RS15670 (SSARUM_003134) | 3288887..3290182 | + | 1296 | WP_060430308.1 | MFS transporter | - |
SSARUM_RS15675 (SSARUM_003135) | 3290210..3291016 | + | 807 | WP_049213249.1 | substrate-binding domain-containing protein | - |
SSARUM_RS15680 (SSARUM_003136) | 3290991..3291890 | - | 900 | WP_033647959.1 | LysR family transcriptional regulator | - |
SSARUM_RS15685 (SSARUM_003137) | 3291983..3292468 | - | 486 | WP_230203728.1 | diacylglycerol kinase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 118 a.a. Molecular weight: 13460.30 Da Isoelectric Point: 8.9000
>T281197 WP_033647956.1 NZ_CP124750:c3288447-3288094 [Serratia sp. K-M0706]
VWEIKTTDAFDNWFSSLHDADRAGVLAALMILREKGPGLPRPYADTVKGSRYSNMKELRIQSRGEPLRAFFAFDPYRIGI
VLCAGNKAGNEKRFYDRMIQAADREFTNWLNTLNEKE
VWEIKTTDAFDNWFSSLHDADRAGVLAALMILREKGPGLPRPYADTVKGSRYSNMKELRIQSRGEPLRAFFAFDPYRIGI
VLCAGNKAGNEKRFYDRMIQAADREFTNWLNTLNEKE
Download Length: 354 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2V4GMA7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2V4GQ69 |