Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 61651..61876 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP124742 | ||
| Organism | Escherichia coli O157:H7 str. EDL933 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | QI555_RS27600 | Protein ID | WP_000813258.1 |
| Coordinates | 61721..61876 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 61651..61709 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QI555_RS27570 (56997) | 56997..57281 | + | 285 | WP_001208773.1 | excisionase family protein | - |
| QI555_RS27575 (57334) | 57334..58644 | + | 1311 | WP_000013654.1 | site-specific integrase | - |
| QI555_RS27580 (59241) | 59241..59870 | + | 630 | WP_000203859.1 | phage antirepressor Ant | - |
| QI555_RS27585 (59918) | 59918..60139 | + | 222 | WP_000763352.1 | TraR/DksA family transcriptional regulator | - |
| QI555_RS27590 (60136) | 60136..61035 | + | 900 | WP_001289938.1 | ead/Ea22-like family protein | - |
| QI555_RS27595 (61035) | 61035..61430 | + | 396 | WP_000426668.1 | hypothetical protein | - |
| - (61651) | 61651..61709 | - | 59 | NuclAT_0 | - | Antitoxin |
| - (61651) | 61651..61709 | - | 59 | NuclAT_0 | - | Antitoxin |
| QI555_RS27600 (61721) | 61721..61876 | + | 156 | WP_000813258.1 | Hok/Gef family protein | Toxin |
| QI555_RS27605 (61996) | 61996..62340 | + | 345 | WP_000756595.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| QI555_RS27610 (62420) | 62420..62608 | - | 189 | WP_000971668.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T281176 WP_000813258.1 NZ_CP124742:61721-61876 [Escherichia coli O157:H7 str. EDL933]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT281176 NZ_CP124742:c61709-61651 [Escherichia coli O157:H7 str. EDL933]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|