Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) hok-sok/-
Location 61651..61876 Replicon plasmid unnamed1
Accession NZ_CP124742
Organism Escherichia coli O157:H7 str. EDL933

Toxin (Protein)


Gene name hokW Uniprot ID A0A1Q4PF16
Locus tag QI555_RS27600 Protein ID WP_000813258.1
Coordinates 61721..61876 (+) Length 52 a.a.

Antitoxin (RNA)


Gene name sokW
Locus tag -
Coordinates 61651..61709 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QI555_RS27570 (56997) 56997..57281 + 285 WP_001208773.1 excisionase family protein -
QI555_RS27575 (57334) 57334..58644 + 1311 WP_000013654.1 site-specific integrase -
QI555_RS27580 (59241) 59241..59870 + 630 WP_000203859.1 phage antirepressor Ant -
QI555_RS27585 (59918) 59918..60139 + 222 WP_000763352.1 TraR/DksA family transcriptional regulator -
QI555_RS27590 (60136) 60136..61035 + 900 WP_001289938.1 ead/Ea22-like family protein -
QI555_RS27595 (61035) 61035..61430 + 396 WP_000426668.1 hypothetical protein -
- (61651) 61651..61709 - 59 NuclAT_0 - Antitoxin
- (61651) 61651..61709 - 59 NuclAT_0 - Antitoxin
QI555_RS27600 (61721) 61721..61876 + 156 WP_000813258.1 Hok/Gef family protein Toxin
QI555_RS27605 (61996) 61996..62340 + 345 WP_000756595.1 YgiW/YdeI family stress tolerance OB fold protein -
QI555_RS27610 (62420) 62420..62608 - 189 WP_000971668.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Hok/gef cell toxic protein

(6-47)


Sequences

Toxin        


Download         Length: 52 a.a.        Molecular weight: 5767.95 Da        Isoelectric Point: 7.7942

>T281176 WP_000813258.1 NZ_CP124742:61721-61876 [Escherichia coli O157:H7 str. EDL933]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK

Download         Length: 156 bp

Antitoxin


Download         Length: 59 bp

>AT281176 NZ_CP124742:c61709-61651 [Escherichia coli O157:H7 str. EDL933]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1Q4PF16

Antitoxin

Download structure file

References