Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 31364..31589 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP124741 | ||
| Organism | Escherichia coli O157:H7 str. EDL933 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | QI555_RS25725 | Protein ID | WP_000813263.1 |
| Coordinates | 31434..31589 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 31364..31422 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QI555_RS25700 (QI555_25705) | 26639..27730 | + | 1092 | WP_001205823.1 | hypothetical protein | - |
| QI555_RS25705 (QI555_25710) | 27737..28483 | + | 747 | WP_000788751.1 | ATP-binding protein | - |
| QI555_RS25710 (QI555_25715) | 28505..29275 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| QI555_RS25715 (QI555_25720) | 29291..29704 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
| QI555_RS25720 (QI555_25725) | 30056..30829 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| - | 31364..31422 | - | 59 | - | - | Antitoxin |
| QI555_RS25725 (QI555_25730) | 31434..31589 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| QI555_RS25730 (QI555_25735) | 31757..32035 | + | 279 | WP_001341388.1 | hypothetical protein | - |
| QI555_RS25735 (QI555_25740) | 32037..33086 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| QI555_RS25740 (QI555_25745) | 33099..33470 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| QI555_RS25745 (QI555_25750) | 33460..33831 | + | 372 | WP_000090264.1 | antiterminator Q family protein | - |
| QI555_RS25750 (QI555_25755) | 33983..34801 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| QI555_RS25755 (QI555_25760) | 35088..35284 | + | 197 | Protein_46 | TrmB family transcriptional regulator | - |
| QI555_RS25760 (QI555_25765) | 35422..36135 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | ompA / espFu/tccP / wza / stx2A / stx2B / iroB / msbA / nueA | 1..286775 | 286775 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T281172 WP_000813263.1 NZ_CP124741:31434-31589 [Escherichia coli O157:H7 str. EDL933]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
Antitoxin
Download Length: 59 bp
>AT281172 NZ_CP124741:c31422-31364 [Escherichia coli O157:H7 str. EDL933]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|