Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/HigB-HigA |
Location | 3406634..3407361 | Replicon | chromosome |
Accession | NZ_CP124740 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | higB | Uniprot ID | U9ZMR4 |
Locus tag | QI555_RS16805 | Protein ID | WP_000550189.1 |
Coordinates | 3406634..3406948 (+) | Length | 105 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | QI555_RS16810 | Protein ID | WP_000560249.1 |
Coordinates | 3406945..3407361 (+) | Length | 139 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QI555_RS16785 (3402792) | 3402792..3403778 | - | 987 | WP_000617675.1 | Gfo/Idh/MocA family oxidoreductase | - |
QI555_RS16790 (3403857) | 3403857..3404549 | - | 693 | WP_000942543.1 | vancomycin high temperature exclusion protein | - |
QI555_RS16795 (3404626) | 3404626..3405129 | - | 504 | WP_001295542.1 | M48 family metallopeptidase | - |
QI555_RS16800 (3405214) | 3405214..3406350 | + | 1137 | WP_000018678.1 | 23S rRNA (guanine(1835)-N(2))-methyltransferase RlmG | - |
QI555_RS16805 (3406634) | 3406634..3406948 | + | 315 | WP_000550189.1 | type II toxin-antitoxin system toxin HigB | Toxin |
QI555_RS16810 (3406945) | 3406945..3407361 | + | 417 | WP_000560249.1 | type II toxin-antitoxin system antitoxin HigA | Antitoxin |
QI555_RS16815 (3407406) | 3407406..3409424 | - | 2019 | WP_000121479.1 | NADPH-dependent 2,4-dienoyl-CoA reductase | - |
QI555_RS16820 (3409950) | 3409950..3412301 | - | 2352 | WP_000695517.1 | alpha-glucosidase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 105 a.a. Molecular weight: 12103.10 Da Isoelectric Point: 10.0409
>T281163 WP_000550189.1 NZ_CP124740:3406634-3406948 [Escherichia coli O157:H7 str. EDL933]
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
MHLITQKALKDAAEKYPQHKTELVALGNTIAKGYFKKPESLKAVFPSLDNFKYLDKHYVFNVGGNELRVVAMVFFESQKC
YIREVMTHKEYDFFTAVHRTKGKK
Download Length: 315 bp
Antitoxin
Download Length: 139 a.a. Molecular weight: 15016.48 Da Isoelectric Point: 4.5805
>AT281163 WP_000560249.1 NZ_CP124740:3406945-3407361 [Escherichia coli O157:H7 str. EDL933]
MIAIADILHAGEKLTAVAPFLAGIQNEEQYIQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
MIAIADILHAGEKLTAVAPFLAGIQNEEQYIQALELVDHLLLNDPENPLLDLVCAKITAWEESAPEFAEFNAMAQAMPGG
IAVIRTLMDQYGLTLSDLPEIGSKSMVSRVLSGKRKLTLEHAKKLATRFGISPALFID
Download Length: 417 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|