Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | symE-agrB/SymE(toxin) |
Location | 1981772..1982184 | Replicon | chromosome |
Accession | NZ_CP124740 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | symE | Uniprot ID | Q8FA88 |
Locus tag | QI555_RS10040 | Protein ID | WP_000132630.1 |
Coordinates | 1981843..1982184 (+) | Length | 114 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 1981772..1981848 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QI555_RS10030 (1978399) | 1978399..1979868 | + | 1470 | WP_001302468.1 | type I restriction-modification system subunit M | - |
QI555_RS10035 (1979868) | 1979868..1981622 | + | 1755 | WP_000110082.1 | restriction endonuclease subunit S | - |
- (1981772) | 1981772..1981848 | - | 77 | NuclAT_15 | - | Antitoxin |
- (1981772) | 1981772..1981848 | - | 77 | NuclAT_15 | - | Antitoxin |
- (1981772) | 1981772..1981848 | - | 77 | NuclAT_15 | - | Antitoxin |
- (1981772) | 1981772..1981848 | - | 77 | NuclAT_15 | - | Antitoxin |
- (1981772) | 1981772..1981848 | - | 77 | NuclAT_16 | - | Antitoxin |
- (1981772) | 1981772..1981848 | - | 77 | NuclAT_16 | - | Antitoxin |
- (1981772) | 1981772..1981848 | - | 77 | NuclAT_16 | - | Antitoxin |
- (1981772) | 1981772..1981848 | - | 77 | NuclAT_16 | - | Antitoxin |
QI555_RS10040 (1981843) | 1981843..1982184 | + | 342 | WP_000132630.1 | endoribonuclease SymE | Toxin |
QI555_RS10045 (1982231) | 1982231..1983394 | - | 1164 | WP_001304006.1 | DUF1524 domain-containing protein | - |
QI555_RS10050 (1983442) | 1983442..1984323 | - | 882 | WP_001304007.1 | DUF262 domain-containing protein | - |
QI555_RS10055 (1984466) | 1984466..1984618 | - | 153 | WP_001418365.1 | hypothetical protein | - |
QI555_RS10060 (1984761) | 1984761..1986173 | + | 1413 | WP_000199295.1 | PLP-dependent aminotransferase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
inside | Genomic island | - | espX6 | 1973971..1995198 | 21227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12294.13 Da Isoelectric Point: 8.4982
>T281155 WP_000132630.1 NZ_CP124740:1981843-1982184 [Escherichia coli O157:H7 str. EDL933]
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
MTDTHSIAQPFEAEVSPANNRQLTVSYASRYPDYSRIPAITLKGQWLEAAGFATGTVVDVKVMEGCIVLTAQPPAAAESE
LMQSLRQVCKLSARKQRQVQEFIGVIAGKQKVA
Download Length: 342 bp
Antitoxin
Download Length: 77 bp
>AT281155 NZ_CP124740:c1981848-1981772 [Escherichia coli O157:H7 str. EDL933]
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
AGTCATAACTGCTATTCCCTATAAATAGTGATTGTGATTAGCGGTGCGGGTGTGTTGGCGCACATCCGCACCGCGCT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|