Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yafN-yafO (relBE)/YafO-YafN |
Location | 1630438..1631132 | Replicon | chromosome |
Accession | NZ_CP124740 | ||
Organism | Escherichia coli O157:H7 str. EDL933 |
Toxin (Protein)
Gene name | yafO | Uniprot ID | C3TNX7 |
Locus tag | QI555_RS08430 | Protein ID | WP_001263495.1 |
Coordinates | 1630438..1630836 (-) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | yafN | Uniprot ID | S1FJN6 |
Locus tag | QI555_RS08435 | Protein ID | WP_000554757.1 |
Coordinates | 1630839..1631132 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
- (1626025) | 1626025..1626105 | - | 81 | NuclAT_12 | - | - |
- (1626025) | 1626025..1626105 | - | 81 | NuclAT_12 | - | - |
- (1626025) | 1626025..1626105 | - | 81 | NuclAT_12 | - | - |
- (1626025) | 1626025..1626105 | - | 81 | NuclAT_12 | - | - |
QI555_RS08405 (1626701) | 1626701..1627159 | - | 459 | WP_001291990.1 | xanthine phosphoribosyltransferase | - |
QI555_RS08410 (1627420) | 1627420..1628877 | + | 1458 | WP_001293009.1 | cytosol nonspecific dipeptidase | - |
QI555_RS08415 (1628934) | 1628934..1629455 | - | 522 | Protein_1654 | peptide chain release factor H | - |
QI555_RS08420 (1629454) | 1629454..1629657 | - | 204 | Protein_1655 | RtcB family protein | - |
QI555_RS08425 (1629976) | 1629976..1630428 | - | 453 | WP_001059871.1 | GNAT family N-acetyltransferase | - |
QI555_RS08430 (1630438) | 1630438..1630836 | - | 399 | WP_001263495.1 | type II toxin-antitoxin system mRNA interferase toxin YafO | Toxin |
QI555_RS08435 (1630839) | 1630839..1631132 | - | 294 | WP_000554757.1 | type I toxin-antitoxin system antitoxin YafN | Antitoxin |
QI555_RS08440 (1631184) | 1631184..1632239 | - | 1056 | WP_001226188.1 | DNA polymerase IV | - |
QI555_RS08445 (1632310) | 1632310..1633095 | - | 786 | WP_000207556.1 | putative lateral flagellar export/assembly protein LafU | - |
QI555_RS08450 (1633067) | 1633067..1634779 | + | 1713 | Protein_1661 | flagellar biosynthesis protein FlhA | - |
QI555_RS08455 (1634924) | 1634924..1635421 | - | 498 | Protein_1662 | REP-associated tyrosine transposase RayT | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 15473.86 Da Isoelectric Point: 8.0949
>T281153 WP_001263495.1 NZ_CP124740:c1630836-1630438 [Escherichia coli O157:H7 str. EDL933]
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
MRVFKTKLIRLQLTAEELDALTADFISYKRDGVLPDIFGRDALYDDSFTWPLIKFERVAHIHLANVNNPFPPQLRQFSRT
NDESHLVYCQGAFDEQAWLLIAILKPEPHKLARDNNQMHKIGKMAEAFRMRF
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|