Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | yefM-yoeB (relBE)/Txe-RelB |
Location | 1974603..1975117 | Replicon | chromosome |
Accession | NZ_CP124737 | ||
Organism | Limosilactobacillus fermentum strain EFEL6800 |
Toxin (Protein)
Gene name | yoeB | Uniprot ID | A0A6C1EMT8 |
Locus tag | P8770_RS10000 | Protein ID | WP_035437199.1 |
Coordinates | 1974854..1975117 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | yefM | Uniprot ID | - |
Locus tag | P8770_RS09995 | Protein ID | WP_035437201.1 |
Coordinates | 1974603..1974857 (+) | Length | 85 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
P8770_RS09960 (P8770_09960) | 1969874..1970161 | + | 288 | WP_282348599.1 | transposase | - |
P8770_RS09965 (P8770_09965) | 1970185..1971063 | + | 879 | WP_282348600.1 | IS3 family transposase | - |
P8770_RS09970 (P8770_09970) | 1971113..1971310 | + | 198 | Protein_1932 | hypothetical protein | - |
P8770_RS09975 (P8770_09975) | 1971606..1972370 | - | 765 | WP_080650602.1 | zinc ribbon domain-containing protein | - |
P8770_RS09980 (P8770_09980) | 1972391..1972852 | - | 462 | WP_282348601.1 | hypothetical protein | - |
P8770_RS09985 (P8770_09985) | 1973168..1974046 | - | 879 | WP_282348602.1 | IS3 family transposase | - |
P8770_RS09990 (P8770_09990) | 1974070..1974357 | - | 288 | WP_041807836.1 | transposase | - |
P8770_RS09995 (P8770_09995) | 1974603..1974857 | + | 255 | WP_035437201.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
P8770_RS10000 (P8770_10000) | 1974854..1975117 | + | 264 | WP_035437199.1 | Txe/YoeB family addiction module toxin | Toxin |
P8770_RS10005 (P8770_10005) | 1975527..1976648 | - | 1122 | WP_100184259.1 | PTS sugar transporter subunit IIC | - |
P8770_RS10010 (P8770_10010) | 1977074..1978471 | - | 1398 | WP_024271998.1 | Na+/H+ antiporter NhaC family protein | - |
P8770_RS10015 (P8770_10015) | 1978859..1979641 | - | 783 | WP_100184711.1 | arginine deiminase-related protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10252.94 Da Isoelectric Point: 10.3349
>T281146 WP_035437199.1 NZ_CP124737:1974854-1975117 [Limosilactobacillus fermentum]
MSYAIKLKRSANKDLKKIKGSYLEKSFLQIIEQLRKDPLAPNQGFEKLVLPIKGFYSRRINIQHRLVYKVDQDTQTVIIY
SAWSHDE
MSYAIKLKRSANKDLKKIKGSYLEKSFLQIIEQLRKDPLAPNQGFEKLVLPIKGFYSRRINIQHRLVYKVDQDTQTVIIY
SAWSHDE
Download Length: 264 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|