Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/- |
Location | 5047602..5048256 | Replicon | chromosome |
Accession | NZ_CP124732 | ||
Organism | Pseudomonas sp. GM17 |
Toxin (Protein)
Gene name | higB | Uniprot ID | - |
Locus tag | PMI20_RS22430 | Protein ID | WP_007929614.1 |
Coordinates | 5047602..5047952 (+) | Length | 117 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | - |
Locus tag | PMI20_RS22435 | Protein ID | WP_007929615.1 |
Coordinates | 5047942..5048256 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
PMI20_RS22420 (PMI20_022420) | 5044353..5045885 | + | 1533 | WP_007929612.1 | NADH-quinone oxidoreductase subunit M | - |
PMI20_RS22425 (PMI20_022425) | 5045893..5047356 | + | 1464 | WP_007929613.1 | NADH-quinone oxidoreductase subunit NuoN | - |
PMI20_RS22430 (PMI20_022430) | 5047602..5047952 | + | 351 | WP_007929614.1 | hypothetical protein | Toxin |
PMI20_RS22435 (PMI20_022435) | 5047942..5048256 | + | 315 | WP_007929615.1 | transcriptional regulator | Antitoxin |
PMI20_RS22440 (PMI20_022440) | 5048428..5050170 | - | 1743 | WP_007929616.1 | ABC transporter substrate-binding protein | - |
PMI20_RS22445 (PMI20_022445) | 5050221..5050493 | - | 273 | WP_007929617.1 | DUF2160 domain-containing protein | - |
PMI20_RS22450 (PMI20_022450) | 5050504..5051304 | - | 801 | WP_007929618.1 | carbohydrate ABC transporter permease | - |
PMI20_RS22455 (PMI20_022455) | 5051316..5052182 | - | 867 | WP_007929620.1 | sugar ABC transporter permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 13763.74 Da Isoelectric Point: 9.3412
>T281130 WP_007929614.1 NZ_CP124732:5047602-5047952 [Pseudomonas sp. GM17]
MDALFIELPPFQRYRQDYLDDELFRSLQLELLKAPEAGDLIEGTGGLRKIRFVDERRHKGKRGGIRVIYYWWSGGAQFWL
FTLYAKNEQSDLAPQQKKLLKQLLNREVEARTHHET
MDALFIELPPFQRYRQDYLDDELFRSLQLELLKAPEAGDLIEGTGGLRKIRFVDERRHKGKRGGIRVIYYWWSGGAQFWL
FTLYAKNEQSDLAPQQKKLLKQLLNREVEARTHHET
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|