Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | higBA (relBE)/COG4683-HTH_37 |
Location | 357867..358513 | Replicon | chromosome |
Accession | NZ_CP124702 | ||
Organism | Klebsiella pneumoniae strain KP21315 |
Toxin (Protein)
Gene name | higB | Uniprot ID | W9BBY1 |
Locus tag | QJQ34_RS01655 | Protein ID | WP_016529833.1 |
Coordinates | 357867..358214 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | higA | Uniprot ID | W8UB68 |
Locus tag | QJQ34_RS01660 | Protein ID | WP_002920557.1 |
Coordinates | 358214..358513 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QJQ34_RS01645 (353793) | 353793..355226 | + | 1434 | WP_002920564.1 | glycogen synthase GlgA | - |
QJQ34_RS01650 (355244) | 355244..357691 | + | 2448 | WP_002920561.1 | glycogen phosphorylase | - |
QJQ34_RS01655 (357867) | 357867..358214 | + | 348 | WP_016529833.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QJQ34_RS01660 (358214) | 358214..358513 | + | 300 | WP_002920557.1 | helix-turn-helix transcriptional regulator | Antitoxin |
QJQ34_RS01665 (358576) | 358576..360084 | - | 1509 | WP_023301456.1 | glycerol-3-phosphate dehydrogenase | - |
QJQ34_RS01670 (360289) | 360289..360618 | + | 330 | WP_002920552.1 | thiosulfate sulfurtransferase GlpE | - |
QJQ34_RS01675 (360669) | 360669..361499 | + | 831 | WP_024622927.1 | rhomboid family intramembrane serine protease GlpG | - |
QJQ34_RS01680 (361549) | 361549..362307 | + | 759 | WP_002920548.1 | DeoR/GlpR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 13549.56 Da Isoelectric Point: 5.6749
>T281104 WP_016529833.1 NZ_CP124702:357867-358214 [Klebsiella pneumoniae]
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
MWDVETTDTFDTWFELQSRALKEDMLATMLILSEFAPQLGRPYVDTVKDSTFQNMKELRVQHHGLPIRAFFAFDPLRKAI
VLCAGDKDGMNEKRFYKEMITLADREFSQHLTKER
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | W9BBY1 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E1CBF8 |